SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007288 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007288
Domain Number 1 Region: 12-320
Classification Level Classification E-value
Superfamily DNase I-like 1.57e-65
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.0000284
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007288   Gene: ENSGACG00000005511   Transcript: ENSGACT00000007306
Sequence length 429
Comment pep:known_by_projection group:BROADS1:groupI:1394892:1400891:1 gene:ENSGACG00000005511 transcript:ENSGACT00000007306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEEQKGSCEEMSFRLHMVTWNVATSDPPEDFTLLLHLNSPKRPDLYVIGLQEVSSRPLR
FVSDSVFDDPWSKKLMETLSPRRYVKLTSIRMQGLLLLVFSKLKHVPFIRDIQTTYTRTG
VFGYWGNKGGVSARLSVYGHMLCFLNCHLAAHMDFASQRVDELEYIVDTQTFHRQKAPKI
DDHRLTFWFGDLNFRIQDHGMHFVRSCIKDRTYDLLWSKDQLTMMKRSEQILQQFEEGPL
DFPPTYKFDPNSDTYDSSGKKRKPAWTDRILWRLRNEAPPSDGPGEEKPLRIRQDMYTSY
MEYVNSDHKPVIGIFTLELRKKYEAPLVSLQPEGDWSTDMDAMVLYRPLQPFPSSAWDWI
GLYKVGFSSVSDYITYTWVSDDQVASNEEVIQKYVSKEEIPVRGAECVLCYYSHTLQSII
GVSEAFKVR
Download sequence
Identical sequences G3NPM4
ENSGACP00000007288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]