SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007292 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007292
Domain Number 1 Region: 3-310
Classification Level Classification E-value
Superfamily DNase I-like 5.76e-65
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.0000287
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007292   Gene: ENSGACG00000005511   Transcript: ENSGACT00000007310
Sequence length 431
Comment pep:known_by_projection group:BROADS1:groupI:1395381:1401575:1 gene:ENSGACG00000005511 transcript:ENSGACT00000007310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFRLHMVTWNVATSDPPEDFTLLLHLNSPKRPDLYVIGLQEVSSRPLRFVSDSVFDDPW
SKKLMETLSPRRYVKLTSIRMQGLLLLVFSKLKHVPFIRDIQTTYTRTGVFGYWGNKGGV
SARLSVYGHMLCFLNCHLAAHMDFASQRVDELEYIVDTQTFHRQKAPKIDDHRLTFWFGD
LNFRIQDHGMHFVRSCIKDRTYDLLWSKDQLTMMKRSEQILQQFEEGPLDFPPTYKFDPN
SDTYDSSGKKRKPAWTDRILWRLRNEAPPSDGPGEEKYPLRIRQDMYTSYMEYVNSDHKP
VIGIFTLELRKKYEAPLVSLQPEGDWSTDMDAMVLYRPLQPFPSSAWDWIGLYKVGFSSV
SDYITYTWVSDDQVASNEEVIQKYVSKEEIPVRGAECVLCYYSHTLQSIIGVSEAFKTPP
RSTHGKKKKQQ
Download sequence
Identical sequences G3NPM8
ENSGACP00000007292 69293.ENSGACP00000007292 ENSGACP00000007292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]