SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007412 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007412
Domain Number 1 Region: 106-430
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 9.38e-61
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000019
Further Details:      
 
Domain Number 2 Region: 452-581
Classification Level Classification E-value
Superfamily Ricin B-like lectins 8.21e-28
Family Ricin B-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007412   Gene: ENSGACG00000005586   Transcript: ENSGACT00000007431
Sequence length 583
Comment pep:known_by_projection group:BROADS1:groupXXI:11694596:11700104:1 gene:ENSGACG00000005586 transcript:ENSGACT00000007431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVTLRYFCYGCLVTSATWSVLLFLYFSLGAEPGLGRTPMQHRSQPITKLPINRKAGLR
PLLANEGVELSPEMGMIFNEADQEVRDSGYHRHAFNVLISTRLGNHRELPDTRDSQCRDK
VYSLALPSASVVICFFNEALSALLRTVHSVLDRTPAYLLHEIILVDDHSELEELKDNLDR
YIKKELQGKVKLVRNRKREGLIRGRMIGASHAAGEVLVFLDSHCEVNQAWLQPLLAPIQK
DRRTVVCPVIDIISADTLSYSPSPIVRGGFNWGLHFKWDPVPPAELNKPEGATGPIRSPT
MAGGLFAMNRKYFNELGQYDAGMDIWGGENLEISFRIWMCGGQLLIIPCSRVGHIFRKRR
PYGSPGGQDTMAHNSLRLAHVWMDEYKEQYLSLRPELHERAYGDVGERVALRKRLQCHTF
RWYLDTVYPEMQILANGNKQPPLFINKGLRRPKVLQRGRLRNLATGRCLVAQGRPSQKGG
VVVLRPCDPRDPEQEWAYDEESQLVLAGLLCLDVSEVRTFDPPRLMKCHGSGGSQQWSQG
KSNRLYQVSVGQCLSVAQPIGPKGYVSMAICDASQAQQWQLEV
Download sequence
Identical sequences G3NPZ6
ENSGACP00000007412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]