SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007430 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007430
Domain Number 1 Region: 116-700
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 1.53e-175
Family Myeloperoxidase-like 0.000000000121
Further Details:      
 
Domain Number 2 Region: 706-759
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000473
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000007430
Domain Number - Region: 753-785
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000739
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007430   Gene: ENSGACG00000005618   Transcript: ENSGACT00000007449
Sequence length 785
Comment pep:novel group:BROADS1:groupXIX:7085211:7089607:-1 gene:ENSGACG00000005618 transcript:ENSGACT00000007449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGSGFVEEALQRAIELTDAAYARTSERVKKSVSEGALRPSDLLAQFKQTEAKTSAQIRAA
ELLDNTVELIREMVYTHTMVQPDHQKALLSERDMENLQQVTGCSAELQRPSCDTDCLSER
YRSITGECNNRHNPRWGAANIPYSRWLPAEYEDLWGMPRGWDPQHTYHNASLPPVRLVSQ
EVLFTHNDNISLDSTLSHLLVEWGQWIDHDVVLTPQSPSRSSFRTGADCTHTCSRDTPCF
PIQIPLSDPRSGFQSCMPFFRSAPSCVAGVPTHRRREQLNAITSFVDASMVYGSSTSLAS
TLRNRSSPLGLMTLNSQHSDRDLAYMPYLPRRQAHLDPCGPRSSLTSRASDFCFLGDSRA
NEHLGMIALHTLFLREHNRLVKELHLINPRWSPDTLYQEARKIMGAVHQILTWEHYLPRV
LGEGAMSRLMPPYEGYDPEVDPSIANVFAAAAFRFAHVTVQPVVTRLGPGYTTNSQHPQL
PLHHSLFASWRVVQVSGGIDPVLRGLLLSPAKLQTPGQMMVEELTERLFQAQGGMPLDLG
ALNLQRGRDHGLPGYGSWRRSCSLSVPNTTSELAEILTNFTLAHKLQLLYGTPHNIDVWV
GAISEPALPGGRVGPLLSCLLARQFRALRDGDRFWWEREGVFTGPQRRHLHGVSLSRIIC
DNSHITHVPADPFSRTERPEDMLPCSHPLISHLDLRPWKEPDSYPDCGLIPRVQSGYSLL
CDSVVLYQCHSGFELLGSSSVSCDPNSRQWSPSAPTCQDIDECKNLTSVCPQHLECFNTQ
GSFIC
Download sequence
Identical sequences G3NQ14
ENSGACP00000007430 69293.ENSGACP00000007430 ENSGACP00000007430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]