SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007605 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007605
Domain Number 1 Region: 1175-1400
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.39e-39
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 2 Region: 224-336
Classification Level Classification E-value
Superfamily Cadherin-like 1.01e-30
Family Cadherin 0.00084
Further Details:      
 
Domain Number 3 Region: 329-433
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-28
Family Cadherin 0.00075
Further Details:      
 
Domain Number 4 Region: 640-752
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-28
Family Cadherin 0.00066
Further Details:      
 
Domain Number 5 Region: 114-222
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-26
Family Cadherin 0.0012
Further Details:      
 
Domain Number 6 Region: 537-639
Classification Level Classification E-value
Superfamily Cadherin-like 1.36e-25
Family Cadherin 0.0017
Further Details:      
 
Domain Number 7 Region: 1424-1619
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.97e-25
Family Laminin G-like module 0.021
Further Details:      
 
Domain Number 8 Region: 740-855
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-24
Family Cadherin 0.0016
Further Details:      
 
Domain Number 9 Region: 9-112
Classification Level Classification E-value
Superfamily Cadherin-like 2.62e-23
Family Cadherin 0.0019
Further Details:      
 
Domain Number 10 Region: 429-541
Classification Level Classification E-value
Superfamily Cadherin-like 1.37e-22
Family Cadherin 0.0018
Further Details:      
 
Domain Number 11 Region: 1114-1154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000718
Family EGF-type module 0.01
Further Details:      
 
Domain Number 12 Region: 848-950
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000157
Family Cadherin 0.0099
Further Details:      
 
Domain Number 13 Region: 2218-2477
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000247
Family Rhodopsin-like 0.039
Further Details:      
 
Domain Number 14 Region: 1752-1792
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000193
Family Laminin-type module 0.0066
Further Details:      
 
Domain Number 15 Region: 1624-1657
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000406
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000007605
Domain Number - Region: 1663-1699
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00113
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 1777-1863
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.0034
Family Hormone receptor domain 0.012
Further Details:      
 
Domain Number - Region: 1095-1118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00699
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 1158-1186
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0492
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007605   Gene: ENSGACG00000005753   Transcript: ENSGACT00000007624
Sequence length 2987
Comment pep:known_by_projection group:BROADS1:groupXII:6969334:7035500:1 gene:ENSGACG00000005753 transcript:ENSGACT00000007624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RARRAANRHPHFSQYNFQVQVAENQPPATSVIIMSASDPDAGDAGRVSYTMAPLMNSRSS
DYFRIHPDTGLISTTQILDREHMDLHYFRVTATDHGSSRLSGTTMVAITIADRNDHSPIF
EQTEYRETIRENVEEGYPILQLRATDLDSPSNANIRYRFVGDTAAMARAAFEIDPRSGLI
TTRGAVDRENNEHYTLQVEASDQGKEPGPRSATVKVFITVLDENDNVPQFSEKRYVVAVK
EDVRPHTEILRVSATDRDKDSNAAVHYNIISGNSRGQFSIDSVTGEIHVVAPLDFESERE
YTLRVRAQDNGRPPLSNNTGIVSVQVTDVNDNPPIFVSTPFQASVLESAPIGSSILHIQA
IDTDSSDNARLEYRLTGTGSDTPFIINSATGWVTVSSILDRESVEHYFFGVEARDYGMPP
LSATASVTITVMDVNDNRPEFLQKEYYARLNEDASVGTSVVTVTAVDRDVNSAVTYQITG
GNTRNRFAISTAGGAGLLSLALPLDYKQERRYVLTVTASDRTLHDTCQVHINITDANTHR
PVFQSAHYSISVNEDRPPGSTVVVISATDDDVGENARITYFLEDNIPQFRIDAGTGAITL
QAELDYEDQMTYTLAITAKDNGIPQKADTTYVEVNVNDVNDNAPQFVSPRYQGTVTEDAP
PFTSVLQISATDRDAHANGRVQYTFQNGEDGDGDFTIEPTSGIVRTVRRLDRESVPFYEL
TAYAVDRGVPPQRTPVHIQVTVLDVNDNAPVFPADDFEVLVKENSAVGSVVAQITATDPD
EGANAQIMYQIVEGNIPEIFQMDIFSGELTSLIDLDYEAHNEYVIVVQATSAPLVSRATV
RIRLVDQNDNRPTLQDFQIIFNNFVSNRSNSFPSGVIGRVPAHDPDVSDRLYYTIDRGNE
LHLLLLNHTSGEIRLSRKLDNNRPLVAPMLITVTDGVHSISAQCILRVLIITEDMLGSSV
TVRLQNMSQEHFLSPLLGNFLEGVSAVLSVPVEDVFIFNIQPDLDAAPGGILNVSFSAAL
PGGLFFPSETLEEQLYLNRPRLTSLTQMEVLPFDDNVCLREPCQNYMKCISVLRFNSSAP
FISSQSILFRPIHPIAGLRCRCPVGFTGDYCETEINLCYSNPCLNGGVCARREGGYTCIC
REDYTGDRCEFDRRQGRCVPGLCRNGGTCRELSGGGFRCECPAGGYERPYCTVTARSFPP
KSFAMFRGLRQRFHLSISLTFATLENSGLLFYNGRFNEKHDFIALEIQEGQVVLKYSTGE
SSTQVSPFLPGGVSDGNWHTVHIHYYNKPKRSMSGEAQGPSDEKVAVVSVDDCDTALSLR
FGTQLGNYSCAAQGKQTSSKKSLDLTGPLFLGGVPNVPDNFPFGTREFIGCMKELHIDSK
PLDMAGFIANNGTLPGCSAKLPFCKSNPCQNGGTCRVSWETFSCDCPLGYGGKDCSHVMP
HAHRFLGNSVLWWDLKNDVTISTPWYLGLVFRTRAREGTLLQAQAGQYTSLLFQVINGQL
VFSVTRGSTRPVRLRLDQVQVADGRWHDVQLELRDVRSGRETRYVATLRLDFGLYQGTVI
VGNEIHGLKVKHLHVGGVLGSGEVQNGIKGCIQGVRLGVRPDSPPLPRPSRTVKVETGCN
VGAPCVSSPCPAHSRCSDQWERHTCDCEPGYYGRGCTDACHLNPCENEAQCHRKPSSSHG
YICDCGDNNYGQYCQHRIDHHCPRGWWGSPTCGPCHCDTNKGFDPDCNKTSGHCHCKEFH
YRVRGSDTCLPCDCYPVGSFSRACDPETGQCQCRPGVIGRQCNICDSPFAEVTNSGCDVI
YDGCPKTITQGIWWPRTKFNLPAAVPCPKGSVGPYTLRHKTGAAIRHCDAERGWMEPDLY
NCTSPPFVELNAALDSLERNETELNTIMEKKLAHQLRDVTEATGRLYGNDLQIAERLLSR
LLTFETQQSGFGLTATQDAHFNENIVRGCSVLMGPGTSALWRALAQSQNHIPGGGPAELT
ELLEQYAQILARNMKLTYLNPVALVAPNIVMNLDRLENQTHVRRRFPRYHTTLFRGQALW
DPNTHVILPPPAAQNAALEPVGISANQTGEYSAARRTVSMPEQPITIVILLIYRSLGGAL
PPKYHTDRRGVRLPRHPVMNSPVVSISVYNNQTFVAGHLDQPILLEFKLLETANRSKPLC
VQWNHSNQYELGGCWTVRDCMVVYRNTSHVRCQCQRLGTFGVLMDSSHREQLEGDLETLA
LVTYSSLCASMLALLLTVLVLSCLRGLKSNTRSIHSNTAAAMLLSELVFLLGVNQTEQQF
LCTVVAILLHYFFMSTFAWMFVEGLHIYRMQTEQRNINYGAMRFYYAIGWGVPAIITGLA
VGLDPEGYGNPDFCWISIYDKLIWSFAGPIAIVILMNGGIFMIVAKMSCNPSQKETKKLP
VIATIRNAFLLLLVATSTWLCGLMSVNNSILAFYYIFNVLCLVQGLSVMLVFTVFNSEVK
EAWSVACLGKKSPGEDQPRPPQNAGQNPYHNASLLEQSGLHRITLGTSTISSVSSARYLN
TQSLRDHEHNISSLLSSFPARENLLARQTLEQNIVHTGATDLDVAMFHRDGGEDSDSDSD
LSMEEERSLSIPSSESEDNVRLRGRIQRRFKRSNHGERLLTEPADLDGNDLLSYWPALEE
CDTHSLQKWGSERPLGADYSKDAANNNQQDAALTSGDENGLTQTNRHRKGILKNRIGCPP
ALQGLSTVGRVPSELNWYRTSTLGHRGVPAASYGRMYSATAGASGGSGSLSQPASRYSSR
EHLDSLSRRQLSRDPLGRQTVGGSRDRLDSRGSRDNLDLLPRRSGSRSHLNSLTRRQASS
REHLGGALMSSRSREQLESNGGGAQAQPCREWLRTLPPRQPSHPDQPPSSSPPPPISEEP
HQEHHPAHVRGRLDSAPPCRYPGQTVPQVAGSSQPLGRQPSSEHLDILSSILASFSSSVL
TPPHAASNPGPNGSAHGPSPSPPQSATSHSISEVSPDSEANRSEGQS
Download sequence
Identical sequences G3NQI9
69293.ENSGACP00000007605 ENSGACP00000007605 ENSGACP00000007605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]