SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

  Home > Genomes > Gasterosteus aculeatus 76_1 > ENSGACP00000007791

Domain assignment for ENSGACP00000007791 from Gasterosteus aculeatus 76_1

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:  ENSGACP00000007791
Domain Number 1 Region: 673-741
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000121
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 2 Region: 984-1045
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000611
Family Complement control module/SCR domain 0.01
Further Details:      
 
Domain Number 3 Region: 87-152
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000256
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 4 Region: 561-622
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000111
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 5 Region: 141-207
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000607
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 6 Region: 205-271
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000175
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 7 Region: 926-981
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000661
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 8 Region: 791-858
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000202
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 9 Region: 727-795
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000499
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 10 Region: 266-336
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000202
Family Complement control module/SCR domain 0.0037
Further Details:      
 
Domain Number 11 Region: 329-393
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000195
Family Complement control module/SCR domain 0.0047
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000007791
Domain Number - Region: 44-93
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00111
Family Complement control module/SCR domain 0.0044
Further Details:      
 
Domain Number - Region: 456-494
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00795
Family Complement control module/SCR domain 0.006
Further Details:      
 
Domain Number - Region: 498-554
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0275
Family Complement control module/SCR domain 0.0045
Further Details:      
 
Domain Number - Region: 628-678
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0715
Family Complement control module/SCR domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007791   Gene: ENSGACG00000005883   Transcript: ENSGACT00000007810
Sequence length 1046
Comment pep:known group:BROADS1:groupVIII:5803165:5824510:1 gene:ENSGACG00000005883 transcript:ENSGACT00000007810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence 
MGVKTQSCVLFLWMYTLTFVKSQECTLEQFVTGPMFDSNYDITNLAATYPAGEQVRVGCN
VGYSGFFKLMCVQGNWESKGKACELRSCGHPGEADSADFHLEKGEDFVFGSQVVYTCQKG
YQMVSRSNIRRCLAAGWDGVVPVCEARQCPPIDVDDNVQVVGNPEEAAYGNVLRFSCKSR
DEILSGSQELYCDENGKWNGKAPICEAITCTVPNIQNGFVNGNVDKYKENEYLSFRCNPS
YKANDGRPSRCLKSGRSANWSPTPLCKPIVCELPLGSQEGTQYEPVSTNVFSPGETVRVT
CGNKYWIDNRLIKSAEITCKENGEWNLRPVCQEVTCSNQKPQHVDFWGIPWRGRITLDET
ARYSCVMDYKKPVGFDLATCTREGWTPNPLCQEIVYFSQDCRIDLVIIGNTIEDVHCLFF
NSLPSRQTMTLACGKMTFLVKGRCSGSDVLNGIVAGPYNDVYYTACREGYKRFTKGWWAT
AECKNGKWSGLEDCIANTTCGKLPEIFNGRVTERPRHNKKFQITCNTGDGVLVKDLTCSD
GEWLSNGLPPQTICSSTAKSCNPPPKVENSIIKASYQREYFSDSEVTYQCRDNYMMEGQG
KKICKDGQWMENIITCTPYCDKLRDESMTFTAAKEIYLNEEFIRYRCDINNLEGIATCVN
TKWNKTRECEVKPCELPDDTDNGYYQIIKGEDFVFGTTIQYFCNEGYQMVSREDTRTCLL
DRWTNHVPICERMSCAPPALVEGVRVQGLPENDDPIIPGRFLTFSCENPGQDLNGSSRLA
CGEDGQWNKPFPSCEDTTCEVGPLQPRVGVTGLPAENEKIKIGHKLQFHCDNHFIIQGSQ
EIECLPTGKWSDAFPTCTGHTGRGCRLTRAQAQSITHRMELKWKIKGKTLRLECIRRGDT
LQRKTVVETNYFPVSLHFHNLLANQDCGEPPFLTNGDTTETSRTHYKRNERVHYTCKAYH
IMEGGPYRTCINGKWSGEMKCLKPCTVDKEAMRSHNIRFRYTWDDKLYSVHLQWIEFTCT
GGRNHVGTIEMRQRCVDGVMLLPTCQ
Download sequence
Identical sequences G3NR25
ENSGACP00000007791 ENSGACP00000007791 69293.ENSGACP00000007791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]
Please cite: Gough, J., Karplus, K., Hughey, R. and Chothia, C. (2001). "Assignment of Homology to Genome Sequences using a Library of Hidden Markov Models that Represent all Proteins of Known Structure." J. Mol. Biol., 313(4), 903-919.

Please send feedback, comments or questions to superfamily@cs.bris.ac.uk or use the feedback form.

© Copyright 2013 The SUPERFAMILY authors and Julian Gough.