SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007793 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007793
Domain Number 1 Region: 143-279
Classification Level Classification E-value
Superfamily TIMP-like 9.16e-28
Family Netrin-like domain (NTR/C345C module) 0.021
Further Details:      
 
Domain Number 2 Region: 89-150
Classification Level Classification E-value
Superfamily BPTI-like 1.29e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0033
Further Details:      
 
Domain Number 3 Region: 27-66
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000692
Family Ovomucoid domain III-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007793   Gene: ENSGACG00000005897   Transcript: ENSGACT00000007812
Sequence length 288
Comment pep:known_by_projection group:BROADS1:groupV:7785564:7787027:-1 gene:ENSGACG00000005897 transcript:ENSGACT00000007812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDGNKAPMGIPKEATCTSFTCTQQGSECDIWDGQPVCKCRDRCEREPHFTCASDGMTYYN
NCFSFTQCHIDKQKPWKVFETYQGCMQCCGPEISGPCGLPSLQGPCKAYEPRWAYSSTLQ
QCQPFIYGGCDGNDNNFESKDVCEETCPYSKIHHCKACKVRGKMVMSFCQSDFVVLGRMT
ELTEEKDSGHALVTVEEILKDQKMGLRFFGKEPLEVTFFNIDWNCPCPNITAAAGEGQVI
IMGNVSAGMAVLQPESYVGSSSPRRVRKLREVISKNTCDVLKAITNSP
Download sequence
Identical sequences G3NR27
ENSGACP00000007793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]