SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007801 from Gasterosteus aculeatus 76_1

(show help)
Strong hits

Sequence:	ENSGACP00000007801
Domain Number 1	Region: 88-155
Classification Level	Classification	E-value
Superfamily	Complement control module/SCR domain	0.00000000000000288
Family	Complement control module/SCR domain	0.0012
Further Details:

Domain Number 2	Region: 335-396
Classification Level	Classification	E-value
Superfamily	Complement control module/SCR domain	0.0000000000000106
Family	Complement control module/SCR domain	0.01
Further Details:

Domain Number 3	Region: 233-287
Classification Level	Classification	E-value
Superfamily	Complement control module/SCR domain	0.000000000153
Family	Complement control module/SCR domain	0.0026
Further Details:

Domain Number 4	Region: 277-332
Classification Level	Classification	E-value
Superfamily	Complement control module/SCR domain	0.00000000017
Family	Complement control module/SCR domain	0.0026
Further Details:

Domain Number 5	Region: 142-210
Classification Level	Classification	E-value
Superfamily	Complement control module/SCR domain	0.00000000131
Family	Complement control module/SCR domain	0.0022
Further Details:

Domain Number 6	Region: 24-77
Classification Level	Classification	E-value
Superfamily	Complement control module/SCR domain	0.00000236
Family	Complement control module/SCR domain	0.0048
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

External link(s)	Protein: ENSGACP00000007801 Gene: ENSGACG00000005883 Transcript: ENSGACT00000007820
Sequence length	397
Comment	pep:known group:BROADS1:groupVIII:5820295:5824796:1 gene:ENSGACG00000005883 transcript:ENSGACT00000007820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MHSSFIFLLLQLWMSVKVSSSQNACSGLPNVPNSQVSENTKKAEYQKGDVVRFTCDTGYI SGPTITYMCSPQSGGWVAVRGGSCYLKPCELPDDTDNGYYQIIKGEDFVFGTTIQYFCNE GYQMVSREDTRTCLLDRWTNHVPICERMSCAPPALVEGVRVQGLPENDDPIIPGRFLTFS CENPGQDLNGSSRLACGEDGQWNKPFPSCEDTTCEVGPLQPRVGVTGLPAENEKIKIGHK LQFHCDNHFIIQGSQEIECLPTGKWSDAFPTCTANQDCGEPPFLTNGDTTETSRTHYKRN ERVHYTCKAYHIMEGGPYRTCINGKWSGEMKCLKPCTVDKEAMRSHNIRFRYTWDDKLYS VHLQWIEFTCTGGRNHVGTIEMRQRCVDGVMLLPTCQ
Download sequence
Identical sequences	G3NR35 ENSGACP00000007801

SEARCH