SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007802 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007802
Domain Number 1 Region: 30-285
Classification Level Classification E-value
Superfamily DNase I-like 1.44e-37
Family DNase I-like 0.0000000889
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007802   Gene: ENSGACG00000005878   Transcript: ENSGACT00000007821
Sequence length 293
Comment pep:known_by_projection group:BROADS1:groupXI:2447647:2450857:1 gene:ENSGACG00000005878 transcript:ENSGACT00000007821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EHLFGSRMRWVCALGLLSALLHLSTSLLLGAFNIKSFGDKKASNATLMNIITTIVHRYDI
ILIQEVRDSDLSATEKLMEHVNKGSPQFRYRHIVSEPLGRSSYKERYLFLYREQTVSVAK
NYTYDDGCEPCGTDAFSREPFVVMFTSKQTAVRTFVLIPQHTSPDYAMRETDALYDVVAD
VRARWNANDIVLLGDFNAGCNYVSGSDWQQIRLFTDKGFHWLIPDEADTTVSHTNCPYDR
IVVTADMMRGVVPGSAKVYDFMADLNLSHSLALAVSDHFPVQVELIGRTAAAA
Download sequence
Identical sequences G3NR36
ENSGACP00000007802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]