SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007852 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007852
Domain Number 1 Region: 478-759
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.41e-50
Family Eukaryotic proteases 0.00000864
Further Details:      
 
Domain Number 2 Region: 203-229,256-474
Classification Level Classification E-value
Superfamily vWA-like 2.91e-39
Family Integrin A (or I) domain 0.0000502
Further Details:      
 
Domain Number 3 Region: 165-221
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000222
Family Complement control module/SCR domain 0.00067
Further Details:      
 
Domain Number 4 Region: 98-161
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000723
Family Complement control module/SCR domain 0.00082
Further Details:      
 
Domain Number 5 Region: 34-84
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000792
Family Complement control module/SCR domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007852   Gene: ENSGACG00000005929   Transcript: ENSGACT00000007871
Sequence length 767
Comment pep:novel group:BROADS1:groupI:2161683:2166868:-1 gene:ENSGACG00000005929 transcript:ENSGACT00000007871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYVWTVLWILLFASEAALQEHDYGDETYEDPRPLNCSTTESIKGGHVTYSQGGLEGSVLT
YHCGVGRYPFPVSQRLCGADGDWSLVRFTDGRRVHRVTCKDVLCPAQLQLDHGDLFPRDQ
WSRVGATQSFSCQDGFTLHGSAQRNCTVSGEWTGSAPACVDHADDCSDPGIPPGALRSAG
RFHAGEKVTYRCQAGLDLLGSAERVCLENREWSGSTPRCQGANSFDSPSVVAAALAGSLA
GVMDVMSPDSKKKDVTGSFARTFRVAEGSRMNVYILLDTSGSIKKQDFELSRSATIALIR
KLDSYEVQLKFHVLSFASETRDIVDIMEPESGNADHVVWSLEQFDHLSHGRKTGTNLHAA
LHRVAEVISFLKQNSAGNHFNETQNIIVIETDGNSNTGRKPQIALNQIRNLLGYSAASRY
HTDETMLDVYVFGIGDQVNKAQLNSIASKKQGENHFFVVKDFQTLGVVFNKIISDHSVTM
CGVAQEREDDMRTYTRPWHVTLERSSKAALCVGSIVSPNWVLTAAHCFNGLSAGDLQQLH
VSHGDGEAVSQKVFIHPEYNVRALEHRNVSEFYDYDVALVQLDRSVPLSWRVRPICLPCT
VPADRAMKRVNSTCQQHRKELLPREETAAFFIHKNDARQQTHVHTESQRPGCVEKARRTL
REPTDVTLEEYIPDRFLCSGGSSGYQDAISCKGDSGGSLFLQKRNRYFQVGVLSWGTTNV
CDSPGRRAHSSLRPPPDARDFHIDLFAVMPWLKQRLGGEVQFLPDVD
Download sequence
Identical sequences G3NR85
ENSGACP00000007852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]