SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007865 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007865
Domain Number 1 Region: 483-770
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.69e-50
Family Eukaryotic proteases 0.00000646
Further Details:      
 
Domain Number 2 Region: 205-231,258-479
Classification Level Classification E-value
Superfamily vWA-like 4.79e-32
Family Integrin A (or I) domain 0.00017
Further Details:      
 
Domain Number 3 Region: 167-223
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000222
Family Complement control module/SCR domain 0.00067
Further Details:      
 
Domain Number 4 Region: 100-163
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000737
Family Complement control module/SCR domain 0.00082
Further Details:      
 
Domain Number 5 Region: 36-86
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000806
Family Complement control module/SCR domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007865   Gene: ENSGACG00000005929   Transcript: ENSGACT00000007884
Sequence length 778
Comment pep:novel group:BROADS1:groupI:2161757:2166771:-1 gene:ENSGACG00000005929 transcript:ENSGACT00000007884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTPFSCQTVCLLFLCAPAALQEHDYGDETYEDPRPLNCSTTESIKGGHVTYSQGGLEGSV
LTYHCGVGRYPFPVSQRLCGADGDWSLVRFTDGRRVHRVTCKDVLCPAQLQLDHGDLFPR
DQWSRVGATQSFSCQDGFTLHGSAQRNCTVSGEWTGSAPACVDHADDCSDPGIPPGALRS
AGRFHAGEKVTYRCQAGLDLLGSAERVCLENREWSGSTPRCQGANSFDSPSVVAAALAGS
LAGVMDVMSPDSKKKDVTGSFARTFRVAEGSRMNVYILLDTSGSIKKQDFELSRSATIAL
IRKLDSYEVQLKFHVLSFASETRDIVDIMEPESGNADHVVWSLEQFDHPFLCSSAGHGRK
TGTNLHAALHRVAEVISFLKQNSAGNHFNETQNIIVIETDGSNSNTGRKPQIALNQIRNL
LVTRFDVFVDTEDVYVFGIGDQVNKAQLNSIASKKQGENHFFVVKDFQTLGVVFNKIISD
HSVTMCGVAQEREDDMRTYTRPWHVTLERSSKAALCVGSIVSPNWVLTAAHCFNGLSAGD
LQQLHVSHGDGEAVSQKVFIHPEYNVRALEHRNVSEFYDYDVALVQLDRSVPLSWRVRPI
CLPCTVPADRAMKRVNSTCQQHRKELLPREETAAFFIHKNDARQQTHVHTESQVGDSLQR
PGCVEKARRTLREPTDVTLEEYIPDRFLCSGGSSGYQDAISCKGDSGGSLFLQKRNRYFQ
VGVLSWGTTNVCDSPGRRAHSSLRPPPDARDFHIDLFAVMPWLKQRLGGEVQFLPDVD
Download sequence
Identical sequences G3NR98
ENSGACP00000007865 ENSGACP00000007865 69293.ENSGACP00000007865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]