SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007875 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007875
Domain Number 1 Region: 144-255
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.36e-33
Family Spermadhesin, CUB domain 0.00078
Further Details:      
 
Domain Number 2 Region: 467-579
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 4.45e-28
Family Frizzled cysteine-rich domain 0.00024
Further Details:      
 
Domain Number 3 Region: 322-415
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.93e-26
Family Spermadhesin, CUB domain 0.00081
Further Details:      
 
Domain Number 4 Region: 419-456
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000017
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 5 Region: 261-298
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000128
Family LDL receptor-like module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007875   Gene: ENSGACG00000005955   Transcript: ENSGACT00000007894
Sequence length 581
Comment pep:known_by_projection group:BROADS1:groupI:2167369:2171903:1 gene:ENSGACG00000005955 transcript:ENSGACT00000007894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDLSQVAVYSDSSELYKNVFCNPAFELEAFCDLTLPIPSPISPHVRCARVTMWLMSRPR
PVRGPACGWVVVAAVCVLLAALGLALALVLTRESPPGVVKGSPVRPNAGDGASQTLSTTS
ASRGPPESTSAPPPTGAPTPETRCGGVLFDSEGSFSSPNHPGSYPPNLLCVWVIRVAPPS
LVQIHVTSLTVEGPSPCLFDWLEVQEQIEQSAVVTRFCGNVAPPTVNTNSSAVRVTFRSD
GSIAGNGFTAQYRAVRPAHKSCSREEFMCDGGRCLLRASVCDGRPNCRDRADEANCSHKR
KVPLFRAPGVTGPFPLSCRASVCPPQLCAWYISVEEGHVVTLSFQNFSLETQDVCEFDYV
EVQDGGEAGVRRVMGRFCGTTFPPDLTSSGPHMTVVFMADEGVADSGFNATYRAVSVQDK
TCGPGQFACSTRECLPQHWLCDGWSDCPDGADEQACGNSTYPPFTSSCEFIEVEMCQGLS
YNLTSFPNIWLSIADQREAATLLRQYRVLMELACFEPLRRLLCGMFLPQCSPQGGVVQPC
RSVCSSAEQQCSQALDLFSFSWPFNCHLLPDSQDPMECSLP
Download sequence
Identical sequences G3NRA8
69293.ENSGACP00000007875 ENSGACP00000007875 ENSGACP00000007875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]