SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007884 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007884
Domain Number 1 Region: 47-123
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000251
Family Growth factor receptor domain 0.0054
Further Details:      
 
Domain Number 2 Region: 111-181
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000272
Family VWC domain 0.062
Further Details:      
 
Domain Number 3 Region: 208-253
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000994
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007884   Gene: ENSGACG00000005961   Transcript: ENSGACT00000007903
Sequence length 361
Comment pep:known_by_projection group:BROADS1:groupX:8660716:8665516:1 gene:ENSGACG00000005961 transcript:ENSGACT00000007903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTWLLVWILTAAGIQQAHSQNSTVMPPATAATSTDAEPYNRTEICKWPCVCPEVAPSCPP
GVSLFLDGCECCKACARQVGEVCNEADTCDYHKGLYCDYSSDKPRYEKGVCAYLGGTGCE
HDGVIYRNGQSFKPSCKYQCVCVDGAIGCVALCTESQPPRVWCQTPRRVKVRGQCCEQWI
CDEPKRGRKTAPRHAVEASPAETRSWHKNCITQTTSWSPCSKSCGRGVSLRVSNANDQCE
LVKESRLCNLRPCEVDITKHIKPGKTCLNIYREEEASHLTISGCTSRKQYRPKYCGVCTD
ERCCIPYKSKTIDVEFECPNGSAFTWQMLWVQACFCNLSCRNPNDIFAGLENYYGYPEVM
N
Download sequence
Identical sequences G3NRB7
69293.ENSGACP00000007884 ENSGACP00000007884 ENSGACP00000007884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]