SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007974 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGACP00000007974
Domain Number - Region: 188-235
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0241
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007974   Gene: ENSGACG00000006031   Transcript: ENSGACT00000007993
Sequence length 417
Comment pep:known_by_projection group:BROADS1:groupX:8748416:8752780:-1 gene:ENSGACG00000006031 transcript:ENSGACT00000007993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDDVITVEFHSPAPDIAPSDVALNWAKAPKAQKQKDGKPTEWTLSDFYDYPSPDDELSA
LDATPELEDTPSFPLEMEDENPLLAGAPAAPAAPAAPDASAAPAAPAAPAAPAAPAAPAA
PAAPAAPAAPAAPVAPANRRPNMDSGSFLPATLMPGMEIADGFGFAGAMGADGCRLGFVR
SGPGVCVSECDSQPNFCFNGGVCTVVAGMGAFCRCNVQDYIWNKGTRCDWAVTEFQVMCA
VVGVASLVVIFLFMIIVFFAKSLHRLKSENIRLRKRSKYRLQSSEPQTDGLSVSTTADGS
QPNVRKLCDTPPIAPQAHTHNLAYYDNIICQRPSTTSYTWECKPRNSYNHFKDDPQKQEY
PAKPPQAKEEGSMNILNSHSPKHENNRPTSVAHDHGHHTPNNTEENAEVNSLQNNLV
Download sequence
Identical sequences G3NRK7
ENSGACP00000007974 ENSGACP00000007974 69293.ENSGACP00000007974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]