SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007979 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007979
Domain Number 1 Region: 340-396
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000458
Family TSP-1 type 1 repeat 0.00035
Further Details:      
 
Domain Number 2 Region: 396-451
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000536
Family TSP-1 type 1 repeat 0.00046
Further Details:      
 
Domain Number 3 Region: 294-336
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000615
Family TSP-1 type 1 repeat 0.00093
Further Details:      
 
Domain Number 4 Region: 454-501
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000405
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000007979
Domain Number - Region: 38-92
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0882
Family Spermadhesin, CUB domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007979   Gene: ENSGACG00000006014   Transcript: ENSGACT00000007998
Sequence length 1528
Comment pep:known_by_projection group:BROADS1:groupVI:7246960:7336430:-1 gene:ENSGACG00000006014 transcript:ENSGACT00000007998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAVRNLLIYIFSTYLLVMFGLTGAQDYWCSTLVKGVIYGSYSVTEMFPKNYTNCTWTLE
NPDPTKYSIYLKLYKRDLSCSEYSLLAYQFDHYSHEKINELLKVNESIVYLCDSKNIYIF
LLYDKNFVQLRRVFPYDYNGLTPQKLDEEEKSNVEFLVLNKASPSQFGCQVLCTWLENCL
KLEKGTVETCGIVYTKCTCPQHLGDGESESMLMLNNVVLPLNPQTEGCLSPQLQAGQICN
LSAEVKRPAKEEYGMIGEHTVKSQRPRSVHDTKALQEQAESAKFMAQTGESGAEEWSQWS
SCSVTCGQGSQVRTRTCVSPYGTHCIGPLRESRVCNNTAPCPVHGVWEEWSPWSLCSFTC
GRGHRTRTRMCAPPQHGGRACDGPETQTKLCNIALCPVDGQWQEWSSWSDCSVTCANGTQ
QRTRQCSAAAHGGSECRGHWAESRECHNPDCTANGQWNPWGPWSGCSKSCDGGWQRRARV
CQGAAQTGQQCDGTGEEVRKCSDQRCPAPYEICPEDYAVSMVWRRTPSGELAFNRCPANA
TGTTSRRCSLDHRGMAYWEQPSYARCITNEFRYLQQSVQGHLAKGQRMLAGDGMSLVTKN
LLDLTQRRNFYAGDLLSSVEILRNVTETFKRASYEPSSDDVQNFFQIISNLLEEENKEKW
EDAQKIYPGAVELMQVIEEFIHIVGLGMKDFHNAYLMTGNLVASIQRLPAVSVMTDINFP
MKGRKGMVDWARNSEDKVVIPKGLFVSQSAVLEMEGSPVFILGTVLYKTLGLMLPSPKNH
TVVNSKVIAVTVRPEPKATDTHLEIELAHLANGTMNPYCALWDSSIMNDSWGAWSARGCR
TVLTDASHTKCLCDRVSTFAILAHQPREITMEYSGVPSVTLIVGCGLSCLSLITLAVIYG
VLWRYIRSERSIILLNFCLSIICSNILILVGQTQTHNVGVCAMTTALLHFFFLASFCWVL
TEAWQSYMAVTGKVRTRLIRKRFLCLGWGLPALVVAVSMGFTKTKGYGTPLYCWLSLEGG
LLYAFVGPAAAVVLVNMVIGILVFNKLVSRDGILDKKLKHRAGQMSEPHTGLTLKCAKCG
VVSTTALSATTASNAMASLWSSCVVLPLLALTWMSAVLAMTDKRSILFQILFAVFDSLQG
FVIVMVHCVLRKEVQDSFRCRLRNCQDPISGDATGTFPNGHAQIMTDFEKDVDIACRSAL
HKDMGSCRATSITGTLSRISLNDEEDEKLPEGLNYSTLPGNIISKVIIQQPSALHMPMGM
GDLKEQCMGDGGDMRRAVYLCTDDAMRQSDHDMEGHSLQGQMMETDYIVMPRASAAAVSG
SGNMNTLLKEDTKMNITMDTLPHERLMHYKMSPDFNISPSGMDHMNVNLEQQYPSAPEQM
QNLPFEPRTAVKNFLAEMEESAGLSRSETGSTISMSSLERRKSRYSDLDFEKVMHTRKRH
MELFQELNQKFQTLDRFRDIPNMGTMDKAMPNKNPWESYNPACEYQNYATMNVLGSDTKD
SLEMTPAEWEKCVNLPLEVQEGDFQTEV
Download sequence
Identical sequences G3NRL2
ENSGACP00000007979 ENSGACP00000007979 69293.ENSGACP00000007979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]