SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008014 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008014
Domain Number 1 Region: 119-308
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.87e-25
Family Laminin G-like module 0.0056
Further Details:      
 
Domain Number 2 Region: 61-97
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000165
Family EGF-type module 0.015
Further Details:      
 
Domain Number 3 Region: 331-374
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000135
Family EGF-type module 0.015
Further Details:      
 
Domain Number 4 Region: 4-59
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000198
Family Laminin G-like module 0.013
Further Details:      
 
Domain Number 5 Region: 378-409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000336
Family EGF-type module 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008014   Gene: ENSGACG00000006061   Transcript: ENSGACT00000008033
Sequence length 411
Comment pep:known_by_projection group:BROADS1:groupVI:7479504:7493073:1 gene:ENSGACG00000006061 transcript:ENSGACT00000008033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGTFGPLFLGDVSSQWEVRDGSAKGTRRFIGCIRELQVNSKEIYLVGEAVRGRNIQDCDP
PVCQHLPCRNGGTCVSDAEDWFCECPPLYTGRLCQFNACERNPCGHGATCIPKSPLEAVC
LCPYGRQGLLCGEPINITQARFGGSDEFGYTSFLAYSSMPSLSLFYEFKLKFTLANYSSA
VKDNLMLFAGHKGQGNAGDDFLVLGLRNGRVLHRFNLGSGVATIVSDRLNDQINVHSVTF
GRSKRTGWLKVDGQRNRTGSAPGLLLGLKVFNQLFVGGYNEYTPELLPLGSRFRHGFLGC
IFDMQFRTRRDGKFQVLGRPAFGRSVGQCGIDPCVHVHCRNGGTCVNSGSSVYCQCPFGW
KGALCSETVSVCDVEHSPPPLCAHGSTCIPLPSGYSCQCPLGAAGLYCGKG
Download sequence
Identical sequences G3NRP7
ENSGACP00000008014 69293.ENSGACP00000008014 ENSGACP00000008014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]