SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008292 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008292
Domain Number 1 Region: 12-154
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.06e-42
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00057
Further Details:      
 
Domain Number 2 Region: 719-895
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.11e-36
Family Laminin G-like module 0.0027
Further Details:      
 
Domain Number 3 Region: 283-453
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.32e-29
Family Laminin G-like module 0.0036
Further Details:      
 
Domain Number 4 Region: 903-1108
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-28
Family Laminin G-like module 0.0075
Further Details:      
 
Domain Number 5 Region: 127-274
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.13e-23
Family Laminin G-like module 0.0092
Further Details:      
 
Domain Number 6 Region: 513-568
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.00000000366
Family Fibrinogen C-terminal domain-like 0.0038
Further Details:      
 
Domain Number 7 Region: 482-517
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000519
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008292   Gene: ENSGACG00000006258   Transcript: ENSGACT00000008311
Sequence length 1244
Comment pep:known_by_projection group:BROADS1:groupVIII:6590103:6632830:1 gene:ENSGACG00000006258 transcript:ENSGACT00000008311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLTEACDSPLVGSLPPPSFRSSSQLTSSHGPVFAKVNRREGAGGWSPLVSDRYQWFEVDL
GRRTCITAVATQGRYGSSDWLTAYLLMFSDTGHNWRQHRQEDSFGAFPGNSNADSVVKYK
LKQPVIARYLRLIPLDWNPSGRIGLRLEIYGCRYTSDVANFDGSSSLVYRRSARPSWKAM
EVVSLKFKTHKNSGTLLHAEGKRDDSLTLVLEKGRLLLYHQQGIKSIPSTLFFLNLTVGS
LLDDQHWHHVKLQRLSTHLNLTVDKNTRQVHTPAELIHWDINQGNVTFSCAEQVSVAVTF
THSQSFLQLPGLTSWSSGVVSMALQFRTWNKAGLLLTFNLLQKGGTVWLYLSEGRLRLQI
NKAGRAELELSAEKGSGLNDGQWHYVELNSRHDHLSITVDTDEGATAHTSIPLLLTTDSQ
LFFGVGCPAQEGSPQCKNPFKVFQGCMRLLTVDNQPVDLIKVQQRLLGKYSHLQIDMCGI
TDRCSPSRCEHGGRCTQSWSTFHCNCSNGGYRGATCHSSKYEKSCEVYKHKGNTSGYYHI
DVDGSGPIKPQLIYCNMTEDVSWMVIRHNNTELTRVHSSPDRHGHLAHFDYASEEEQLAA
VISQSERCEQELSYLCRKSRILNTPEGAPLAWWVGGAGPGEIQTHWGGALPGSRQCACGL
QDNCLDSNHYCNCDADLEQWANDSGLLTHKGSLPVRSLVLGDIQREGSEAAYRVGPLRCH
GDRNFWNAAFFDKETSYLHFPTFHGELSADIAFLFKTKSSSGVFLENLGIKDFIRIELRS
ASEVVFSFDVGNGPLEVRVETSVRLNDNRWHSIRAERNVKEASLRVDGFPAAVHEAPADG
HTQLQLNSQLFIGGTASRQKGFLGCIRSLQLNGVTLDLEERAKVTPGVRPGCPGHCSSYG
SLCQNQGRCVERVIGFSCDCDQSAYTGAFCHEEVSASFKSSTSVAYKFKESYEAKRNIST
SPFSIYSDLTLRGENISLSFRTSQCPALLLYVNSFHREYLALLINKHNELELRYKLHGSR
DVEVMGSGVTNLADGLLHTVTIRRLADAVTVQIDQNAKEHFSLTSDMEFNGIKSLILGRV
QEFEEVDAELSSLASLGFTGCLSGVCFNSISPLKAALLHPDSPVIVSGPLVQSSCGGSST
SANPYTTETTHSLSDQPGSVDPGQPLVNSIRSDSVLVGGVIAVVTFVTVSAMAIMGRFIC
SRKETYRKQEVKTAAQPEDCHELPFSGRAESLGAPSENQKEYFI
Download sequence
Identical sequences G3NSH4
ENSGACP00000008292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]