SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008304 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008304
Domain Number 1 Region: 31-202
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.8e-74
Family Ephrin receptor ligand binding domain 0.00000118
Further Details:      
 
Domain Number 2 Region: 330-421
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000035
Family Fibronectin type III 0.0043
Further Details:      
 
Domain Number 3 Region: 259-321
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000212
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008304   Gene: ENSGACG00000006268   Transcript: ENSGACT00000008323
Sequence length 448
Comment pep:known_by_projection group:BROADS1:groupXVIII:3938009:3965753:-1 gene:ENSGACG00000006268 transcript:ENSGACT00000008323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSWSTPCLWITFCLYLCCHVDSGEAQNAKEVILLDSKAQQTDLEWISYPPNGWEEISGL
DENYTPIRTYQVCQVMEPNQNNWLRTNWIEKGNAQRIFVELKFTLRDCNSLPGVVGTCKE
TFNLYYQETDSEVGRSLRENQYVKIDTIAADESFTQGDLGERKMKLNTEVRIIGPLTRRG
FYLAFQDVGACIALVSVKVYYKKCWSIIENLATFPDTVTGSEFSSLVEVEGVCVNDAEEE
ADNSPKMHCSAEGEWLVPIGKCICKAGFHQKGDACEPCGRGFYKSSSQDLQCSRCPAHSF
NDREGSWRCDCEDGYYRALSDPASVACTRPPSAPQNLVYNINQTTVSLEWSPPADTGGRN
DVTYRVVCRRCGWEPEECVPCGLNVGYSPAQSGLVDTYVSIVDLLAHANYTFEVEAVNGV
SDLSRTQRLFAAVSIATGQAGKGSYKQS
Download sequence
Identical sequences G3NSI6
ENSGACP00000008304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]