SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008337 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008337
Domain Number 1 Region: 132-258
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 1.5e-51
Family XPF/Rad1/Mus81 nuclease 0.00000108
Further Details:      
 
Domain Number 2 Region: 256-325
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.00000000000000191
Family Hef domain-like 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008337   Gene: ENSGACG00000006301   Transcript: ENSGACT00000008356
Sequence length 333
Comment pep:known_by_projection group:BROADS1:groupXVI:12003228:12005697:-1 gene:ENSGACG00000006301 transcript:ENSGACT00000008356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKRFNINLDDTAFVKERTPVGIYKNKPSSAKAASEPVERPFSYADYIVQSKRTVAAPAQ
TERCSKLLQKSLCESDPVSSASGRCEGEGGSEGDKKSEDPQVTGTHQKEGNGHPRSDPSP
SLGPKPVGSGSSIIVSPRQRGNPILKFVRTVPWEFGDVAPDYVLGQTTCALFLSLRYHNL
NPNYIHDRLKQLGHTFILRVLLVQVDVKDPHHTLKELARICIMADCTLILAWSPEEAGRY
LETYKSYEKKPADLLKEQVEKNYLSKVTDCLTTVKSINKTDAITLLSTFSSVEGIINASK
EDLVLCPGLGPQKARRLHDVLHKPFLKSKTKDS
Download sequence
Identical sequences G3NSL9
ENSGACP00000008337 69293.ENSGACP00000008337 ENSGACP00000008337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]