SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008358 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008358
Domain Number 1 Region: 746-854
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-33
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 2 Region: 48-162
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.67e-32
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 3 Region: 1028-1137
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-30
Family Spermadhesin, CUB domain 0.00051
Further Details:      
 
Domain Number 4 Region: 1367-1485
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-29
Family Spermadhesin, CUB domain 0.00094
Further Details:      
 
Domain Number 5 Region: 1195-1315
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-29
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 6 Region: 399-508
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.67e-28
Family Spermadhesin, CUB domain 0.00082
Further Details:      
 
Domain Number 7 Region: 1554-1657
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-27
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 8 Region: 572-680
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-27
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 9 Region: 225-335
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-25
Family Spermadhesin, CUB domain 0.00093
Further Details:      
 
Domain Number 10 Region: 1908-1976
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.53e-19
Family Complement control module/SCR domain 0.00083
Further Details:      
 
Domain Number 11 Region: 1965-2033
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.12e-18
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 12 Region: 2204-2274
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.81e-17
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 13 Region: 2263-2335
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.5e-17
Family Complement control module/SCR domain 0.00096
Further Details:      
 
Domain Number 14 Region: 2147-2215
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.7e-17
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 15 Region: 2024-2090
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.64e-17
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 16 Region: 2324-2393
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.26e-16
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 17 Region: 2444-2512
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.2e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 18 Region: 2079-2140
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000126
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 19 Region: 2383-2439
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000528
Family Complement control module/SCR domain 0.00087
Further Details:      
 
Domain Number 20 Region: 1141-1203
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000167
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 21 Region: 860-925
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000459
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 22 Region: 1658-1731
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000709
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 23 Region: 686-750
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000723
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 24 Region: 1313-1382
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000189
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 25 Region: 1720-1782
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000283
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 26 Region: 1849-1906
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000334
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 27 Region: 2503-2560
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000584
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 28 Region: 168-227
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000648
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 29 Region: 1794-1860
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000661
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 30 Region: 341-403
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000863
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 31 Region: 1484-1549
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000122
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 32 Region: 512-574
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000167
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 33 Region: 920-959
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000105
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 34 Region: 1-59
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000792
Family Complement control module/SCR domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008358   Gene: ENSGACG00000006307   Transcript: ENSGACT00000008377
Sequence length 2802
Comment pep:known_by_projection group:BROADS1:groupXX:5843406:5955450:1 gene:ENSGACG00000006307 transcript:ENSGACT00000008377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NARRFGDSFQLGSSISVVCEEGFIKTQGADTITCQLEEGKGMWSGLIPKCEAPCGGHYSG
PSGVILSPGWPGYYKDSLSCEWVVEAEPGSSIKISFDRFQTELSYDFLEVHDGPNLLSPL
IGSFNGTQVPQFLFSSSNFLYLLFTTDNSRSNSGFKILFEVVTLDTYSCMDPGIPVNGLR
LSHVLSIGSTVSFQCDPGYRLSHDEPLVCEKNHFWSHPLPTCDASCGGDIRGPGGIILSP
GFPELYPNSLNCTWTVEVSHGKGVQFTFYSFHLEDHHDYLLITENGSFAQPLARLTGSER
PSPVNAGLYGNFKAQLRFISDFSISLQGFNISFSEYDLEPCQDPGTPLFGWHTGSRFGIG
DSLSFYCNTGYRLQGARAVVCLGGGRHMWSAPLPRCVAECGSTVSNNEGVILSPNYPKNY
DNSHECVYTIQVQTGKGINISASTFQLAQSDILKVYDGKDGAALLLGTYTGTSMQGLSLT
STSNYLWLEFYSDQEATAAGFRLLYHSFELSHCDDPGVPQFGFKVSDQGHFAGSAITFGC
DQGYTLHGRGILKCMTGDRRAWDNNLPSCIAECGGSFKGESTGRILSPGYPFPYDNNLRC
TWTIEVNSGNIVSLQFLAFDTEASHDILKVWDGPPEKEMSLQEVSGSLLPAGIHSTLNVV
TIQFETDFYITKSGFAIDFSSSLATACRDPGIPMNGSRNGEGPEPGDLVTFSCDPGYELQ
GESRITCIQVENRYYWQPSPPSCIAPCGGNVTGSSGFILSPNYPHPYPHSKDCDWLIAVH
SDYVISLAFISFSIEPNYDFLYIYDGSDSSTHLIGSFQDSKLPEKIESTSNFMYLAFRSD
GSVSYTGFHLEYKAKLREACFDPGNVMNGSRMGTDYKLGSMVTFHCEAGYLLQGYSTLTC
VMGNSKRPEWDRAKPSCQAPCGGHFTGSEGTVLSPNYPHNYTRGQSCVYDIFVPGDFAVP
EDGDSHCKWNTEKSQGQLFWNKILGTSLVTKHSSPCFMPHGVRNQLKCVSLGNTLQYYHI
LFSLRLVPCGGVLTHRRGTILSPGYPELYTNYLNCAWKISVPEGAGIQIQVVTFATEHNW
DSLDFFDGVDGNAPRLGSYSGTTIPQLLNSTSNNLYLTFQSDISVSAAGFHLEYTAIGLD
SCPEPLPPSNGQRVGDRYTVGDMVSFQCDQGFSLQGNAYITCMPGPVRRWNYPAPLCLAQ
CGGAMTDFSGVILSPGFAGNYQSSLDCNWRVQLPIGFGIHLQFLNFSTEPVHDYLEVRSG
NLETATVIDRFSGPVVPNSLFSTTHETTLFFHSDYSQNKPGFHIVYQAYELQRCPDPRPF
SSGIVIGQDYSVGMTISFECLQGYTLLGEPSLTCLHGVSRNWNHPVPRCEALCGGNVTSM
NGTIYSPGHPAEYPHFQDCMWTVRVPPGYGIYINFSVINTEPIYDYITVWDGPDQAAPQI
GQFSGNSVQEGVSTTANQVLIKFHSDFSTSGFFVLHYYAYQLRACQPPPPVANATILTDD
EEFEIGDIIRYSCLPGFTLVGSEILTCRLGERLQMDGPPPVCQVQCPAHEVRFDSTGVIL
SPGYPDNYPNLQMCSWLINVEKGYNMTLHFELFQTEKEFDILEIFDGPNIYSQSLASLSG
DIETPFSLTTTGHQLLLRWSSDHGTNRHGFHIRYVAMYCSTPDSPQHGFVVSQTGGHLNS
MVRWACDRGYKLIGKGSAVCKKTTYGYYAWDAPVPACQAVSCGVPSAPANGGVLATDYSV
GTRVTYFCNSGYRLSSKELTTTVCQPDGTWSIHNKIPRCIGSVLTCPSLSSFSLEHGKWR
IVNGSHYEYGTKIIFTCNPGYYRAGPARIQCLANGVWSWRNERPRCRIISCGDVPTPSNG
KRIGTQTTFGASAIFSCDLGYVLTGSTVRECLLSGLWSGTETHCLAGHCGLPEQIVNGQV
IGENFGYRDTVVYQCNPGFRLIGSSVRICQQDHNWSGQLPVCISITCGHPGSPIYGRTTG
DGFNYNDLVRFSCNKGYTLEGPSTAQCQADRQWSQQPPTCRVVNCTDPGIPANSIRESKI
EHGIFTFGSVVFYDCNPGYYLFGSSVLTCQPVGHWDKPLPECIEVDCGHPGTPPHGVMSG
EMFTVGSTVRYSCSGDRQLIGDSSLTCQLNGHWSGPLPHCSGDSADTCGDPGTPVHATRE
AGNFKVRSKVRFTCAVGHTLYGSAERICFPNGTWSGRQPFCKPVQCGNPATPAHGRISRV
DGTTFSHSIVFSCMEGYFLTGSPTRQCLANGTWSGTNPNCTMITCGEPGIPANGLRFGEE
ITVGQNVTFMCQLGYVMTGADSAVTRTCTNNGTWSGTMPACKVVTCPTPRLVPNGLLEGS
VLEWGTSVSYSCLPGYELSFPAVLTCAGNGTWSGDLPQCLPKFCGDPGVPARGRREGRSF
IFKSEVTFSCNTLYFLVGSTTRVCQEDGMWSGSQPRCIEPTRTTCENPGTPEHGFMNYTT
GFKVGSRVDFQCQQGHLLQGSTTRLCLPDLTWTGIQPRCIPHSCKQPRSPANADVVGLDL
PSYGYTLVYTCQSGYFLSGGSEHRVCRSDGSWTGKVPVCRVGSKSHEKTVKPVPGTPSPK
IHVPDNVFASDFVWKGSYDYKGQKQPMTLTVRSFNATTGKVNVTLTDSSMEFLLSGVYKR
QEARLMLLLHQMRALAHSSLSRITDETWAMDGFVSAEPEGGSYVFQGFIQGKDFGRFGLQ
RLGLSVRENVTLTDPETNGSTNSSSVAVAILVPFFALIFAGLGFYLYKQRKTDKAQYTGC
SVHENNNGQATFENPMYNTNTKAAEGKVVRFDPNLNTICTMV
Download sequence
Identical sequences G3NSP0
ENSGACP00000008358 69293.ENSGACP00000008358 ENSGACP00000008358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]