SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008436 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008436
Domain Number 1 Region: 202-262
Classification Level Classification E-value
Superfamily BPTI-like 2.7e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0031
Further Details:      
 
Domain Number 2 Region: 331-385
Classification Level Classification E-value
Superfamily BPTI-like 8.09e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.002
Further Details:      
 
Domain Number 3 Region: 275-311
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000406
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 4 Region: 112-203
Classification Level Classification E-value
Superfamily PKD domain 0.00000392
Family PKD domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008436   Gene: ENSGACG00000006368   Transcript: ENSGACT00000008455
Sequence length 468
Comment pep:known_by_projection group:BROADS1:groupXV:2776075:2780737:-1 gene:ENSGACG00000006368 transcript:ENSGACT00000008455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLARFKNGRDDFVLDADESVNDGATFISSPPLTRQRDCVAACCKDPECNVAFMERGDEEG
AVKSCFLFDCVYNKKYACRFFRKTGYISSILDSVYESYLAVDARSKSRAADRPPMANGGP
DRVVQPQDTVRLNGMASADDNKELTFQWKMLTSYPFAVIEKTGFDDEIAVSNLTSGVYKF
QLTVTDSIGQSDTTKVTVLVLTPEQSEHHCMVPPKVGPCRGSFPRWHYNAASEKCEEFTF
GGCRPNLNNYLSKEECSKACSSSVLVPRPEKCGVECADGEFTCANGCCLAPGLECDLISQ
CSDGSDEQTCNDLENNFRILLQIPVDEQKGLRCTELPDTGTCRDSLTKWYYDPLQEHCLP
FNYGGCQGNNNRFDTEEVCARMCRGVTGNDVFAKQKTTPNGLTTGNTGVVAIAAILGVAI
FVLLCIVVYCLMKSKKKTSQRRHDPVNTVPVTLEDRERLVYNSTTKPI
Download sequence
Identical sequences G3NSW8
ENSGACP00000008436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]