SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008480 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008480
Domain Number 1 Region: 44-111
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000146
Family Growth factor receptor domain 0.0045
Further Details:      
 
Domain Number 2 Region: 202-246
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000419
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008480   Gene: ENSGACG00000006402   Transcript: ENSGACT00000008499
Sequence length 348
Comment pep:known_by_projection group:BROADS1:groupXVIII:4474533:4479124:-1 gene:ENSGACG00000006402 transcript:ENSGACT00000008499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSLLCRSLLLILAQQCFSWAQNNGQLAPRDRGAAAERRQFCQWPCKCRQRPHCAPGVSS
VLDGCGCCKSCARQIGDPCNERDVCDPHKSMYCDFSADKPRYEVGVCAYLMAVGCDLNGA
HYENGEGFQPSPLYKCTCIAGAIGCTPAFIQKPVSLLSPAPLMGNLPAGLRSSLSPKKHR
QDTTYMSVLKAYRDPPLAWKKNCLIQSTPWSPCTKTCGLGISVRVNNDNGKCEMRKDRRL
CLLRPCEKSVMRSVKVQKGKTCRPKFQAKKAEKLTLSGCTSTKKFKPMYCGVCTDKRCCV
PNKSSMIKVNFTCKAGSNTEWKMQWITSCVCQRKCNDPGDMFSDLRLL
Download sequence
Identical sequences G3NT12
ENSGACP00000008480 69293.ENSGACP00000008480 ENSGACP00000008480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]