SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008636 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008636
Domain Number 1 Region: 19-196
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.23e-67
Family Ephrin receptor ligand binding domain 0.000000293
Further Details:      
 
Domain Number 2 Region: 611-888
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.57e-67
Family Protein kinases, catalytic subunit 0.00000000138
Further Details:      
 
Domain Number 3 Region: 324-531
Classification Level Classification E-value
Superfamily Fibronectin type III 1.95e-38
Family Fibronectin type III 0.0000345
Further Details:      
 
Domain Number 4 Region: 914-984
Classification Level Classification E-value
Superfamily SAM/Pointed domain 6.68e-19
Family SAM (sterile alpha motif) domain 0.00053
Further Details:      
 
Domain Number 5 Region: 254-327,362-383
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000137
Family Growth factor receptor domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008636   Gene: ENSGACG00000006527   Transcript: ENSGACT00000008655
Sequence length 990
Comment pep:novel group:BROADS1:groupVIII:6867135:6904286:1 gene:ENSGACG00000006527 transcript:ENSGACT00000008655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AFYCCLLKSYLPLSFCLSETVMDTRTATAELGWISFPANGWEEVSGYDENLNTIRTYQVC
NVFEPSQNNWLLTTYVDRRAAQRIYVEIRFTVRDCASIPSVLGSCKETFNLYYLETERTL
SEGIKGVEYWANAPFLKVDTIAADESFSQVDFGGRLMKVNTEVRSFGPLSKGKGFHLAFQ
DLGACMSLLAVRVFYKKCPSVVQNFALFPETLTGAESTSLVIARGSCIANAEEVDVPIKL
YCNGDGEWMVPIGSCSCKAGYEPDNGNVCRACPQGTFKSFQGVGLCQQCPLNSRSTIEAA
TVCGCRSGFYRGDMDKPEDVCTSVPSAPRNVVSVVNQTSVQLEWHPPRDIGYRDDLSYNV
VCRRCHSSGRRACQPCDDGVAFVSGKQGLKDTKVEISKLRAHTSYTFEIQAVNGVSNKSP
YPAQQLSINITTNQAAPSVVPIMHQVSSTSRSFSLSWPPPEQPNGIILDYEIRYFDKSLS
SVQNSSVVQSKTPSVVLEGLKLGTGYVVQVRARTVAGYGGYSKEMLFQTLTDDEYKSELG
QQLSLIAGSLVAGVCIVSLVAIAIICTRRRQCKESVYADKLQQYNAGGHSSPGVKIYIDP
FTYEDPNEAVREFAKEIDPSCVKIEEVIGSGEFGEVYRGRLKPVGKKEILVAIKTLKVGY
SERQRRDFLSEASIMGQFDQPNIIRLEGVVTKSRPTMIITEFMENGALDSFLRQNDGQFP
VIQLVGMLRGIASGMYFLDKMIYQGPTKVLWNPMKSSNELVCKVSDFGLSRYLEEDTSDP
TYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVTWEVMSFGERPYWDMSNQDVINA
IEQDFRLPAPMDCPVVLHQLMLDCWQKDRNARPKFPDIVSMLDKMIRNPASLKAGTNNVA
PGPPHHALLDRAGPDLSSVSSVEDWLAALKMTQYRDSFLGSGFTSLPLVTQMTAEDLQRI
GVSLAGHQKKILTSAQSMRHNVDDQSPTES
Download sequence
Identical sequences G3NTG8
ENSGACP00000008636 ENSGACP00000008636 69293.ENSGACP00000008636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]