SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008643 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008643
Domain Number 1 Region: 9-186
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.19e-68
Family Ephrin receptor ligand binding domain 0.000000293
Further Details:      
 
Domain Number 2 Region: 314-466
Classification Level Classification E-value
Superfamily Fibronectin type III 2.42e-27
Family Fibronectin type III 0.00038
Further Details:      
 
Domain Number 3 Region: 244-317,352-373
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000294
Family Growth factor receptor domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008643   Gene: ENSGACG00000006527   Transcript: ENSGACT00000008662
Sequence length 473
Comment pep:novel group:BROADS1:groupVIII:6867265:6885474:1 gene:ENSGACG00000006527 transcript:ENSGACT00000008662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPLSFCLSETVMDTRTATAELGWISFPANGWEEVSGYDENLNTIRTYQVCNVFEPSQNNW
LLTTYVDRRAAQRIYVEIRFTVRDCASIPSVLGSCKETFNLYYLETERTLSEGIKGVEYW
ANAPFLKVDTIAADESFSQVDFGGRLMKVNTEVRSFGPLSKGKGFHLAFQDLGACMSLLA
VRVFYKKCPSVVQNFALFPETLTGAESTSLVIARGSCIANAEEVDVPIKLYCNGDGEWMV
PIGSCSCKAGYEPDNGNVCRACPQGTFKSFQGVGLCQQCPLNSRSTIEAATVCGCRSGFY
RGDMDKPEDVCTSVPSAPRNVVSVVNQTSVQLEWHPPRDIGYRDDLSYNVVCRRCHSSGR
RACQPCDDGVAFVSGKQGLKDTKVEISKLRAHTSYTFEIQAVNGVSNKSPYPAQQLSINI
TTNQAAPSVVPIMHQVSSTSRSFSLSWPPPEQPNGIILDYEIRYFDKVGSQKF
Download sequence
Identical sequences G3NTH5
ENSGACP00000008643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]