SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008876 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008876
Domain Number 1 Region: 372-636
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-57
Family YWTD domain 0.0000000114
Further Details:      
 
Domain Number 2 Region: 287-366,636-682
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000008
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 3 Region: 116-157
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000011
Family LDL receptor-like module 0.00045
Further Details:      
 
Domain Number 4 Region: 168-205
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000327
Family LDL receptor-like module 0.00038
Further Details:      
 
Domain Number 5 Region: 1-37
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 6 Region: 78-117
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000367
Family LDL receptor-like module 0.00056
Further Details:      
 
Domain Number 7 Region: 40-78
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000772
Family LDL receptor-like module 0.00043
Further Details:      
 
Domain Number 8 Region: 204-245
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000825
Family LDL receptor-like module 0.00021
Further Details:      
 
Domain Number 9 Region: 249-283
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000563
Family LDL receptor-like module 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008876   Gene: ENSGACG00000006705   Transcript: ENSGACT00000008895
Sequence length 875
Comment pep:known_by_projection group:BROADS1:groupXI:3392552:3398595:1 gene:ENSGACG00000006705 transcript:ENSGACT00000008895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRATQFQCGNRKCLTARWVCDGTDDCGDNTDELPGTCAAKTCRPTEFRCAGRLNQCVPSS
WRCDGKADCQNGADEEGCAPKQCTDGEFRCTNGQCVSSSFVCDEEADCDDGSDEASCRPA
TCSATSFRCSNGVCVPRLWACDGDTDCADGSDEWPQHCGTTAPNSAAAHQCSSLEFRCGN
GECIHSSWKCDGGADCRDRSDEVNCSLSTCRPDEFQCGDGTCIHGSRQCNRQYDCQDLSD
ETGCVNATHCDGPSRFKCKSGECISMEKVCDTRRDCRDWSDEPLRDCGSNECLYNNGGCS
HICNDLKIGYECLCPAGYHLVEKRRCEDIDECANLDTCSQICINQIGSYKCQCEEGYQVD
PATKACKAIGTIAYLFFTNRHEVRKMTLDRSEYTRIIPRLKNVVAIDMNMAANEIYWSDI
SQKKIYRAPVDSAEDPAHHRVVIGSDVDAPEGIAFDWIHGNLYWTDSIRRTISMVTADGS
RRKTLFDQDLSKPRAIVLDPHSNFIYWTDWGNAAKIEMAGLNGGDRTALVTDNIEWPNGI
TLDLLNQRLYWVDSKLHTLSSISVQGGGRRTLIIDEHKLAHPLSLTVFEESVFWTDVSNN
AIFSANRVTGEDITPVAEHLSSPDDIILYHNLKQPTGRNWCEISGCEFLCLAAPQVGGHA
PKYTCVCPDNMMLARDMRTCVPDIKLSIFSSSSAPVSDSLLLFLVFRQPAVPTPAAPVQP
TESPSTTSKPHVHATLRPATGPVPRGTKPPVRTTTPEPRTPSPRPTNPEIPKTTTGSPVT
SPDFKHRFVAAIPSTASPAPISLYIALPLALVCLVAGGGVLLWRNYRLKNTNTIHFDNPV
YQKTTEDQVHIYRSHSPDGYSYPKRQVVSLEEETD
Download sequence
Identical sequences G3NU58
69293.ENSGACP00000008876 ENSGACP00000008876 ENSGACP00000008876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]