SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008929 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008929
Domain Number 1 Region: 810-1096
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.27e-79
Family Protein kinases, catalytic subunit 0.000000000367
Further Details:      
 
Domain Number 2 Region: 526-713
Classification Level Classification E-value
Superfamily Fibronectin type III 3.21e-29
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 3 Region: 322-424
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000086
Family I set domains 0.069
Further Details:      
 
Domain Number 4 Region: 423-545
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000073
Family Fibronectin type III 0.0073
Further Details:      
 
Domain Number 5 Region: 105-194
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000113
Family I set domains 0.057
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000008929
Domain Number - Region: 196-318
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00596
Family Growth factor receptor domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008929   Gene: ENSGACG00000006730   Transcript: ENSGACT00000008949
Sequence length 1114
Comment pep:known_by_projection group:BROADS1:groupVIII:7192745:7205051:-1 gene:ENSGACG00000006730 transcript:ENSGACT00000008949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVIDLTMISTAEVTSVNRFTISCINGERNPGPLDIKKDNKIFVLSKAPNFKVYKPSNKKS
VARNFSDLHHVGIFYCESKQEVPPLETATMINNYGTGNFIPNYLTLTANKGETVHLSMQI
LSSQERDVTWKYNGNYYYMTHWNDVINRTAVLTVENAALANQGIYSASFVGDSPLHGAWM
RLIVRDCPSKKWGPSCDKDCPECLNGGVCHDVDGDCICPPGFMGTRCETACREGMFGRNC
QGSCDSKLNCKGLRFCLPDPYGCSCASGWFGSRCEKDCQNDMYGPDCRLSCKCQNGGACN
RFSGCQCPTGWRGQNCEKSDRAPQILDLVSNVQWNLNSSPKILCSATGNPLPSHNSIELR
KLDSTVLKASRTVMDSNKSTASFEIPRLTAQQGGLWECRVSTNGGQDSRKFNLTIKEPPV
PTTAPKLLEKRSKQLLVMPVDSHRGDGPIVSTRLLYKPVENVHSWSSIIVYSDKEPITLM
NLEPSTRYSVRVQLSRPGEGGEGAPGPEAIMETDCPEPTLQPEIDISSVEGRNVTVRWRL
PANNGINAGTASGFLVQLFGPPPFSEKLLEETTLLTVLSTKFHNMKYLHDYTVVVRLINC
GSLGPLSKPYHFRINSQGPSSPRNIQALPLSISAIQVRWQPPEDPNGGIIKYIIEYQAVG
QGTPHPWVDTDDGNKTTKAVTALNGSTLYQFRVRAFSKVPGEWSKIVQAMTQGDGLQSLA
PATQGVAGRPAVESYQLLVAVVGSVTVTCVTILLALLALFFIRKTLLNRRRTFTYQSGSG
EETILQFNSGTLTLTRRPKPTPEALTYPILEWEDIKFEDVIGEGNFGQVIKAMIKKDGSK
MSAAIKMLKEYASENDHRDFAGELEVLCKLGQHPNIINLIGACENRGYLYIAIEYAPYGN
LLDFLRKSRVLETDPAFAKEHGTASTLTSQQLLQFAVDVATGMHYLSDKQFIHRDLAARN
VLVGDSLVAKIADFGLSRGEEVYVKKTMGRLPVRWMAIESLNYSVYTTKSDVWSFGVLLW
EIVSLGGTPYCGMTCAELYEKLPQGFRMEKPKNCDDEVYELMKQCWRDRPYERPPFSQIS
VQLNRMQEARKAYVNMALFENFTYAGIDATAEEA
Download sequence
Identical sequences G3NUB1
ENSGACP00000008929 ENSGACP00000008929 69293.ENSGACP00000008929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]