SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009055 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009055
Domain Number 1 Region: 376-637
Classification Level Classification E-value
Superfamily YWTD domain 9.55e-58
Family YWTD domain 0.0000000376
Further Details:      
 
Domain Number 2 Region: 171-209
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000942
Family LDL receptor-like module 0.00057
Further Details:      
 
Domain Number 3 Region: 259-371,642-681
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000455
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 4 Region: 207-248
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000851
Family LDL receptor-like module 0.00033
Further Details:      
 
Domain Number 5 Region: 3-40
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 6 Region: 121-159
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000916
Family LDL receptor-like module 0.00068
Further Details:      
 
Domain Number 7 Region: 86-122
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000114
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 43-81
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000707
Family LDL receptor-like module 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009055   Gene: ENSGACG00000006827   Transcript: ENSGACT00000009075
Sequence length 857
Comment pep:known_by_projection group:BROADS1:groupVIII:7401543:7460248:1 gene:ENSGACG00000006827 transcript:ENSGACT00000009075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKTCATTDFACKNGQCVPGRWRCDGEPECADGSDEADAICRRQTCSPEKFDCGGAASKCV
SLSWRCDGERDCENGADEDQCAADAQACPSKDFQCLNGKCVAPIFVCDGDDDCGDASDEV
KCSAPTCGQHEFRCNDSECIPALWSCDGDPDCKDKSDESMERCSRRTEPQKPRCPVGEFL
CGSGECVHMNWKCDGDADCKDKSDEANCPLLTCRPDEFQCGDGSCIHGTKQCNKVHDCPD
YSDEAGCVNVTKCDGSRKFRCKNGECIDRSKVCDNVKDCKDWSDEPMKECGLNECVDNNG
GCSHICKDRRIGYECDCPSGYRLLDKKTCGDINECENPDACSQICINYKGDYKCECYEGY
EMDPASKTCKAVGKSPYLMFTNRHEIRRIDLLKSEYTQVVPTLKNAVALDVDVSTNKMFW
CDLYHRKIYSAYINKASDSSQHLTLIDSLLSPEGLAVDWVHKNIYWTDSGNKSISVATGD
GRKRKVLIATELSEPRAIAVDPHQGFMYWSDWGGQAKIEKSGMNGVDRQVLVSEHIEWPN
GITLDLSNRRLYWVDSKLHLLSSVDLNGDNRKVLLSSQQHLGHPFALSVFEDRVYWTDLE
DEAIYSANRLTGHDVAKVAEHLNNPLDLVVFHEQRQPKAPDTCNMGSLPNGGCEYLCLKA
PQITDHSPKYTCACPDDMELGPDMRRCAMGSTTTSAATTLRPTTRRLTTPAAPKTPRRTS
TEQPRTPVATTTQTTSFSSTRRASTSTHAPLLGPNGIQRESNGNLSHRGKGHGNNITVAV
LGIVIPIVVIGLLCTGGYLVWRNWRRKNTKSMNFDNPVYRKTTEDDDDEIHIGRHSESIG
HVYPARVALSLEDDGYP
Download sequence
Identical sequences G3NUN6
ENSGACP00000009055 69293.ENSGACP00000009055 ENSGACP00000009055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]