SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

  Home > Genomes > Gasterosteus aculeatus 76_1 > ENSGACP00000009133

Domain assignment for ENSGACP00000009133 from Gasterosteus aculeatus 76_1

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:  ENSGACP00000009133
Domain Number 1 Region: 122-164
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000000851
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 2 Region: 40-76
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000249
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 3 Region: 163-204
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000034
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 4 Region: 246-286
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000223
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 5 Region: 207-246
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000055
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 1-32
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 289-327
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000537
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 8 Region: 81-124
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000903
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009133   Gene: ENSGACG00000006865   Transcript: ENSGACT00000009153
Sequence length 331
Comment pep:known_by_projection group:BROADS1:groupV:9180548:9186504:1 gene:ENSGACG00000006865 transcript:ENSGACT00000009153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence 
CSTDQFRCDEGKCIPDSWVCDSIQDCSDATDEPLSCKDQIRTCGPSQFTCTNGNCIPQSL
VCDGNNDCWDTSDEAPELQCGQQTCSSDQFTCPTWFPSYPRCVPLSFVCDGEKNCANAAD
ELHNCPNRTCHMNEFACSNGICILLPYHCDRVNDCGDGSDELHCAYDTCSSHQFTCGNGA
CIPASFTCDGQSDCTDGSDEAESLCAPPRPTCAPQQFMCKSGDCIDVGKVCNGQKDCGDN
SDEKGCELNTCRPGRFQCDSGHCIPAALQCDGRPDCQDLTDETSCLNVTCEMPSRFRCAN
GYCIYSGLLCNQKDECGDGSDEKEELCKISH
Download sequence
Identical sequences G3NUW4
ENSGACP00000009133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]
Please cite: Gough, J., Karplus, K., Hughey, R. and Chothia, C. (2001). "Assignment of Homology to Genome Sequences using a Library of Hidden Markov Models that Represent all Proteins of Known Structure." J. Mol. Biol., 313(4), 903-919.

Please send feedback, comments or questions to superfamily@cs.bris.ac.uk or use the feedback form.

© Copyright 2013 The SUPERFAMILY authors and Julian Gough.