SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009272 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009272
Domain Number 1 Region: 41-134
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.7e-19
Family Canonical RBD 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009272   Gene: ENSGACG00000007001   Transcript: ENSGACT00000009292
Sequence length 234
Comment pep:known_by_projection group:BROADS1:groupX:9691561:9694257:1 gene:ENSGACG00000007001 transcript:ENSGACT00000009292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSSTVFAPLSYITGLIVEDAQKPRSSNQTSPSLKLSNGFILPEGKLTPNALFVGGIDMKV
DENEMRDFFARYGVVKEVKIITYRGGICKGYGFVYFNEEVNIQSIIEQQISFKGRKLKLG
PAIMKERSSRSMPSRLVGPAPWISPTPYFYCGCSAPMGGSMAQPSPVLNGGTPYNHPYSY
SNFGGVMIPHMPLNYAQNAYAYQSSLPLTRSDHSTRPVNQNFVDCGVQTMMTVL
Download sequence
Identical sequences G3NVA3
69293.ENSGACP00000009272 ENSGACP00000009272 ENSGACP00000009272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]