SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009329 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009329
Domain Number 1 Region: 25-75
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000549
Family Plexin repeat 0.0031
Further Details:      
 
Domain Number 2 Region: 89-169
Classification Level Classification E-value
Superfamily Integrin domains 0.0000000889
Family Integrin domains 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009329   Gene: ENSGACG00000007040   Transcript: ENSGACT00000009349
Sequence length 169
Comment pep:known_by_projection group:BROADS1:groupXX:7879606:7881037:-1 gene:ENSGACG00000007040 transcript:ENSGACT00000009349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALKLLAYLGLLLVLSCLSGAEEQKCSTSAHNCDECIQSGPACAWCSAPNANIRCDTLK
GLQRAGCHKSYVFNPRGRVQVVKNDSGTEPADAEALSLRPRDVSLRLRPGVSESFPLTIT
VPTAQPITELIMDTSALPAGVNVSFSTIVNENPLLVVQVTVTAAQCPSE
Download sequence
Identical sequences G3NVG0
69293.ENSGACP00000009329 ENSGACP00000009329 ENSGACP00000009329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]