SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009459 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009459
Domain Number 1 Region: 1-84
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.57e-20
Family THAP domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009459   Gene: ENSGACG00000007143   Transcript: ENSGACT00000009479
Sequence length 222
Comment pep:known_by_projection group:BROADS1:groupXI:3829828:3831589:1 gene:ENSGACG00000007143 transcript:ENSGACT00000009479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCSAYGCTKRHCKGSDVNFFRFPFGDNVRLNQWLLNVRRRNWSPSKSSRLCSTHFKEDQ
FFIDNEGKRRLKETAVPTIFVFQNHWLIEDVTNTITQTSLLSLKTNIGGEPYHNVVNSEQ
APIEEDDDTANYGVDGVLDDVLDDDDIVRVIVGGEVDEVISDDDTEGSTSVTPQSALHDH
SYRSLKQEQIYVDTDHNYIVSGSPRTLKRKVDAVQDQLILAH
Download sequence
Identical sequences G3NVU0
ENSGACP00000009459 69293.ENSGACP00000009459 ENSGACP00000009459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]