SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009611 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009611
Domain Number 1 Region: 250-288
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000113
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 2 Region: 149-240
Classification Level Classification E-value
Superfamily PKD domain 0.000011
Family PKD domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009611   Gene: ENSGACG00000007258   Transcript: ENSGACT00000009631
Sequence length 433
Comment pep:known_by_projection group:BROADS1:groupXVIII:6012779:6017592:-1 gene:ENSGACG00000007258 transcript:ENSGACT00000009631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PISDLKSKLSGVEELLEEFRQQLTQDPTRRAGDALDSCAGDFDAVGERIIRTKASIERGA
TFLLVPDRVYTWKDCVRACCSQPHCTVAVVQQDRRQLGDTLSCYLFNCTYRGASVCSFAP
QQGFTTYSRSPNATAPLWFFLCDAADADEPPRSDAGQDVVIQLPTDWAVLDGRDSVDDRG
INRYDWTLVKGDTAINMKATHPGLLKVSGLQEGVYSFQMTVTDTSGQRSSDNVSVTVLAP
KHQAEVCTGFCSKYQFKCDDGCCIDITFACDGKQHCTDRSDEIFCPIFDSNRKSSTDPAD
LSNRHGLVSQPEEAEDGSVLQTGPRKNIENLVPPQDRSEAAFPLNPSQGGPSDSHGKVIR
AESNAPVSKPFPGMGGHPVPESGAILPLTLGLIITAVLLLMIGCRLRLVGHRLKKARPLT
TEESDYLINGMYL
Download sequence
Identical sequences G3NW92
ENSGACP00000009611 69293.ENSGACP00000009611 ENSGACP00000009611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]