SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009694 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009694
Domain Number 1 Region: 294-416
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000957
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 2 Region: 166-287
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000753
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 65-206
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000643
Family Growth factor receptor domain 0.018
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000009694
Domain Number - Region: 1000-1037
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000273
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 906-1035
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00282
Family Growth factor receptor domain 0.007
Further Details:      
 
Domain Number - Region: 1470-1505
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0108
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 527-572
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0203
Family Laminin-type module 0.054
Further Details:      
 
Domain Number - Region: 613-660
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0481
Family Laminin-type module 0.069
Further Details:      
 
Domain Number - Region: 1430-1460
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0533
Family Laminin-type module 0.079
Further Details:      
 
Domain Number - Region: 785-834
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0607
Family Laminin-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009694   Gene: ENSGACG00000007302   Transcript: ENSGACT00000009714
Sequence length 1527
Comment pep:known_by_projection group:BROADS1:groupI:5496803:5535584:-1 gene:ENSGACG00000007302 transcript:ENSGACT00000009714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PNVCADQEMSMMAARQPCVQAFSRMIKVWKQGCTNHRWCAGYERRTSYYTVYRQVYSADL
RTVYKCCPGWTQEGEEMGCLHNVNECEVEDGGCEESCCNTIGSYYCKCPEGSRLGPDGKA
CRDVNECEEVNGGCQQTCVNTKGSFHCECREGFRMHSDGRTCIAVNSCSILNGGCEHKCV
DTGNNNYKCDCRKNYQLKRDGRHCELRDPCEHRNGGCSQLCLSQHGRVHCSCRPGFTLSG
DGENCEDIDECRSGRAECSHGCVNMLGSFSCVCHQGFELGADGKQCYRIEMEIVNSCEKN
NGGCSHHCEHTTNGPSCSCNHGYQLDRHRKTCVDSDECVSGESCCRHLCRNHPGGYECSC
RAGHRLSPDGCGCDDIDECQAETSGCEQNCVNTLGTYECFCELGFRLDQDQHSCVALYGR
ELEEEGNAPQLLRYTAALRSRHGGDGGDGETEYEIQRERRGELRLDSSIVCLDGSFGEEC
SVSCDDCVHGKCSDGRDGCECSAGWTGIVCNKTCPQGTYGQACDSLCRCQNGGSCDPLTG
KCVCPPGVQGLLCEDGCPRGYFGRHCRKKCNCPNNGHCNRMYGGCLCSPGLYGRFCHLPC
PRWTHGAGCSKECDCVQEHSAGCDPKTGSCFCKAAYHGPRCEKECELGSFGAGCEQPCVC
PGGGSCDPGTGECSRRCPAGLHGDTCQLACRSKSYGEGCRLTCDCGDAPCDAVTGRCICP
AGKTGHSCQEDCPDGFWGLKCQSPCPKCENRGSCNKHTGVCDCQPGFTGKLCQNECPPGV
HGPGCSMRCSCPSDATCDPLTGRCICPPGKRGHDCATSCESGYWGQECLSKCRCEGTSLH
CDPVTGQCACEAGFTGDHCEKKCMNGSYGPACVQQCQCHNGAQCDHVSGACTCPPGHAGT
YCEKMCPDSFYGLDCGQMCECRNGARCHHITGGCLCTAGWAGPHCTLECPDGYFGERCSQ
TCECQSAGTCDHVSGRCSCAARGLGSAAMLQCEEGTHGENCAQTCSCANGGRCDAVARRC
VCVCPPGWTGELCQSADFTSASRLIGYCLTLFLYCAECSRVSCVFCTLEPVRKGFFGEGR
VQRCACVHGSGWHHVTGRCECEPGPEGVQTESRASHPGSYGASCAQRRRCPGVSCHHRTG
RCGCPAGLTGAWLREKTCPTGMFGQNCSKPCRCPGEREQCHPVTGKCSCLPGYYGARCEL
RCPAGTFGPSCKSRCSCINGGRCDSSTGICYCLPGFIGADCSSSCPSGYYGKDCGKLCSC
GDGGQCHSADGTCICAPGRMGQSCQQACPRGRYGLQCRNACSCHNGGRCDPGDGTCQCGL
GWTGARCDTACSHGKYGLDCAQECQCLNNGTCDRFTGTCTCAAGFYGHACQHECPPGFFG
VNCAHVCDCETWHTCDHVTGRCVCPPGHYGPQCQRRCEAGRFGLSCGQSCDCAGGSPCEA
STGRCLCPPGRTGRRCEKASRPGGDRYGPDCSLPRQCSHGARCDGRSGRCLCPLTWLGPT
CSDAPANPGAAEPFRVPKKEKSRLQKH
Download sequence
Identical sequences G3NWH5
ENSGACP00000009694 ENSGACP00000009694 69293.ENSGACP00000009694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]