SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009723 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGACP00000009723
Domain Number - Region: 3-20
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.0549
Family Integrin beta tail domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009723   Gene: ENSGACG00000007340   Transcript: ENSGACT00000009743
Sequence length 57
Comment pep:novel group:BROADS1:groupXIX:8520292:8520870:-1 gene:ENSGACG00000007340 transcript:ENSGACT00000009743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIIYCHAKKENSCWFQFLKCKDLLHICSISLEIKNGTQLMYIHRSVSICHVFVCGAI
Download sequence
Identical sequences G3NWK4
ENSGACP00000009723 ENSGACP00000009723 69293.ENSGACP00000009723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]