SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009750 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009750
Domain Number 1 Region: 4865-5078
Classification Level Classification E-value
Superfamily GFP-like 7.53e-57
Family Domain G2 of nidogen-1 0.00082
Further Details:      
 
Domain Number 2 Region: 2872-2960
Classification Level Classification E-value
Superfamily Immunoglobulin 2.83e-24
Family I set domains 0.01
Further Details:      
 
Domain Number 3 Region: 2480-2566
Classification Level Classification E-value
Superfamily Immunoglobulin 1.38e-23
Family I set domains 0.0098
Further Details:      
 
Domain Number 4 Region: 4069-4165
Classification Level Classification E-value
Superfamily Immunoglobulin 2.1e-23
Family I set domains 0.0074
Further Details:      
 
Domain Number 5 Region: 2575-2661
Classification Level Classification E-value
Superfamily Immunoglobulin 5.75e-23
Family I set domains 0.011
Further Details:      
 
Domain Number 6 Region: 4427-4521
Classification Level Classification E-value
Superfamily Immunoglobulin 8.56e-23
Family I set domains 0.012
Further Details:      
 
Domain Number 7 Region: 3140-3240
Classification Level Classification E-value
Superfamily Immunoglobulin 9.51e-23
Family I set domains 0.0031
Further Details:      
 
Domain Number 8 Region: 2385-2472
Classification Level Classification E-value
Superfamily Immunoglobulin 1.1e-22
Family I set domains 0.012
Further Details:      
 
Domain Number 9 Region: 3794-3893
Classification Level Classification E-value
Superfamily Immunoglobulin 1.37e-22
Family I set domains 0.0052
Further Details:      
 
Domain Number 10 Region: 3982-4075
Classification Level Classification E-value
Superfamily Immunoglobulin 1.54e-22
Family I set domains 0.014
Further Details:      
 
Domain Number 11 Region: 3329-3429
Classification Level Classification E-value
Superfamily Immunoglobulin 1.64e-22
Family I set domains 0.0067
Further Details:      
 
Domain Number 12 Region: 2291-2379
Classification Level Classification E-value
Superfamily Immunoglobulin 2.5e-22
Family I set domains 0.012
Further Details:      
 
Domain Number 13 Region: 2952-3051
Classification Level Classification E-value
Superfamily Immunoglobulin 3.34e-22
Family I set domains 0.004
Further Details:      
 
Domain Number 14 Region: 3428-3523
Classification Level Classification E-value
Superfamily Immunoglobulin 4.09e-22
Family I set domains 0.0088
Further Details:      
 
Domain Number 15 Region: 785-883
Classification Level Classification E-value
Superfamily Immunoglobulin 5.68e-22
Family I set domains 0.0058
Further Details:      
 
Domain Number 16 Region: 613-704
Classification Level Classification E-value
Superfamily Immunoglobulin 6.39e-22
Family I set domains 0.01
Further Details:      
 
Domain Number 17 Region: 3044-3146
Classification Level Classification E-value
Superfamily Immunoglobulin 7.99e-22
Family I set domains 0.0099
Further Details:      
 
Domain Number 18 Region: 1083-1174
Classification Level Classification E-value
Superfamily Immunoglobulin 1.18e-21
Family I set domains 0.0081
Further Details:      
 
Domain Number 19 Region: 3610-3708
Classification Level Classification E-value
Superfamily Immunoglobulin 1.22e-21
Family I set domains 0.0066
Further Details:      
 
Domain Number 20 Region: 1907-2004
Classification Level Classification E-value
Superfamily Immunoglobulin 1.33e-21
Family I set domains 0.015
Further Details:      
 
Domain Number 21 Region: 3703-3800
Classification Level Classification E-value
Superfamily Immunoglobulin 1.82e-21
Family I set domains 0.013
Further Details:      
 
Domain Number 22 Region: 43-219
Classification Level Classification E-value
Superfamily vWA-like 1.85e-21
Family Integrin A (or I) domain 0.025
Further Details:      
 
Domain Number 23 Region: 4354-4440
Classification Level Classification E-value
Superfamily Immunoglobulin 2.26e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 24 Region: 2673-2760
Classification Level Classification E-value
Superfamily Immunoglobulin 3.38e-21
Family I set domains 0.02
Further Details:      
 
Domain Number 25 Region: 1812-1912
Classification Level Classification E-value
Superfamily Immunoglobulin 3.62e-21
Family I set domains 0.0053
Further Details:      
 
Domain Number 26 Region: 1166-1254
Classification Level Classification E-value
Superfamily Immunoglobulin 4.54e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 27 Region: 2782-2864
Classification Level Classification E-value
Superfamily Immunoglobulin 4.77e-21
Family I set domains 0.019
Further Details:      
 
Domain Number 28 Region: 4158-4256
Classification Level Classification E-value
Superfamily Immunoglobulin 5.48e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 29 Region: 1532-1631
Classification Level Classification E-value
Superfamily Immunoglobulin 6.85e-21
Family I set domains 0.0048
Further Details:      
 
Domain Number 30 Region: 2085-2182
Classification Level Classification E-value
Superfamily Immunoglobulin 7.34e-21
Family I set domains 0.0063
Further Details:      
 
Domain Number 31 Region: 1347-1444
Classification Level Classification E-value
Superfamily Immunoglobulin 2.29e-20
Family I set domains 0.013
Further Details:      
 
Domain Number 32 Region: 887-983
Classification Level Classification E-value
Superfamily Immunoglobulin 2.38e-20
Family I set domains 0.018
Further Details:      
 
Domain Number 33 Region: 3236-3336
Classification Level Classification E-value
Superfamily Immunoglobulin 2.56e-20
Family I set domains 0.005
Further Details:      
 
Domain Number 34 Region: 1719-1818
Classification Level Classification E-value
Superfamily Immunoglobulin 2.83e-20
Family I set domains 0.0077
Further Details:      
 
Domain Number 35 Region: 1998-2096
Classification Level Classification E-value
Superfamily Immunoglobulin 4.2e-20
Family I set domains 0.013
Further Details:      
 
Domain Number 36 Region: 3880-3982
Classification Level Classification E-value
Superfamily Immunoglobulin 5.78e-20
Family I set domains 0.015
Further Details:      
 
Domain Number 37 Region: 1440-1538
Classification Level Classification E-value
Superfamily Immunoglobulin 1.08e-19
Family I set domains 0.013
Further Details:      
 
Domain Number 38 Region: 4250-4344
Classification Level Classification E-value
Superfamily Immunoglobulin 2.52e-19
Family I set domains 0.0094
Further Details:      
 
Domain Number 39 Region: 2193-2284
Classification Level Classification E-value
Superfamily Immunoglobulin 3.39e-19
Family I set domains 0.013
Further Details:      
 
Domain Number 40 Region: 703-798
Classification Level Classification E-value
Superfamily Immunoglobulin 7.55e-19
Family I set domains 0.026
Further Details:      
 
Domain Number 41 Region: 1638-1725
Classification Level Classification E-value
Superfamily Immunoglobulin 1.29e-18
Family I set domains 0.0056
Further Details:      
 
Domain Number 42 Region: 3520-3616
Classification Level Classification E-value
Superfamily Immunoglobulin 2.5e-18
Family I set domains 0.013
Further Details:      
 
Domain Number 43 Region: 520-615
Classification Level Classification E-value
Superfamily Immunoglobulin 3.24e-18
Family I set domains 0.033
Further Details:      
 
Domain Number 44 Region: 979-1071
Classification Level Classification E-value
Superfamily Immunoglobulin 2.14e-17
Family I set domains 0.0076
Further Details:      
 
Domain Number 45 Region: 1243-1347
Classification Level Classification E-value
Superfamily Immunoglobulin 3.58e-17
Family I set domains 0.0058
Further Details:      
 
Domain Number 46 Region: 4576-4634
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000654
Family TSP-1 type 1 repeat 0.00039
Further Details:      
 
Domain Number 47 Region: 5084-5227
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000141
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 48 Region: 4690-4748
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000445
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 49 Region: 4748-4805
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000157
Family TSP-1 type 1 repeat 0.00033
Further Details:      
 
Domain Number 50 Region: 4633-4691
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000183
Family TSP-1 type 1 repeat 0.00022
Further Details:      
 
Domain Number 51 Region: 4521-4577
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000746
Family TSP-1 type 1 repeat 0.00056
Further Details:      
 
Domain Number 52 Region: 5409-5523
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000455
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 53 Region: 5187-5265,5292-5347
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000471
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 54 Region: 4807-4858
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000222
Family TSP-1 type 1 repeat 0.00045
Further Details:      
 
Domain Number 55 Region: 449-523
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000175
Family I set domains 0.051
Further Details:      
 
Domain Number 56 Region: 5263-5299
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000143
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009750   Gene: ENSGACG00000007309   Transcript: ENSGACT00000009770
Sequence length 5631
Comment pep:known_by_projection group:BROADS1:groupVIII:8358318:8421177:1 gene:ENSGACG00000007309 transcript:ENSGACT00000009770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVGSEMGSRLVWLSLFLSVPLCAGRDAGTGAAEEDIPEGASTLAFVFDVTGSMYDDLVQV
IEGASKILETSLSRPKKTLYNFALVPFHDPEIGPVTITTDPKKFQYELRELYVQGGGDCP
EMSIGAIKIALEISLPESFIYVFTDARSKDYRLTNEVLQLIQQKQSQVVFVLTGDCDDRT
HIGYKVYEEIASTSSGQVFHLDKKQVNEVLKWVEEAVQSSKVHLLSTDHFSAASNTWQMP
FDPSLKEVTVALSGPAPNIEIRNPQGKLMGTSDGLTELLHIPNSAKVVNIKDPQSGMWSI
KTSSEGRHSVRISGLSTIDFRVGFSRKPTLDFKKTSSRPVQGIPTHILLNTTGLSPPAVA
DRVELLTIKGDVIKTLPIRYYPGREPFGLWNITEFIPPNEAFFLRVAGYDRDGFLFQRVS
SVSFSSIVPDAPKVLMPATSHGYYLQKGSVPCQVESLVPFTLRFSRDGRRLGEDQLFSES
NHASWSIAQVTVKDEGYYECIAISRAGTGRARTFLDVSEPPPAITVEGNVTASPGSRAVL
TCHVVSTVSFNLTWLRGGLDARLDPRVRVLANLSLQVPAVTPDHSGWYECIAINKGGMQA
EQIYLTVQEVPRVLVEPRNQTFAAGEEMRIRCSASGYPPPRLVWTHNDKFIMASSRHRMT
PDGTLVIRNMEKKDAGVYGCLGSNKAGTDTMYSILTYIESPVVTVALSDLLIGIGETTAM
ACSASGIPQPEIWWYKGGVQLRSSSYLDVDTFGGSLTIKETQDVDAGDYTCVAVNAAGSS
SGKISLDVGGAPKFTREPSDVAFDIGSNVTLLCLVKGHPEPQVTWKREDGLPIFNRPRSY
GTITQSREGLHITNLWVEDEGVYICEAHNHFGTVQAQATITVTGLVSPVIAMSPSVLSVI
EGQQVTLPCMLLAGNPLPERQWLHNYGLVTSDHYVTVRRDGSLHIERVRLDDAGDYTCLA
ENVIGATNHTTAVNIYVIPTIQYGPQVFSTIEGTAITLPCRGSGVPPPDITWTKGGELMN
LGGPAFSLDSDGSLLITSPSGNETGEFICTATNAAGYASRKVQLIVYVRPRSNVRGAGGS
ADPMKMSVIEGEDAVLPCEVHGVPPPTISWAKERQLISPFSPRHTQLTSGSMKILETRVS
DSGLYVCVALNIAGNTTQSIELSVLVPPSIQAGPRVIKVQVGHSVELPCVVRGFPEPALT
WTKDGKRYPASSDGSLALGDVVLADEGTYTCTATSTAGRDQAQVQLLVQVPPVVEVLEPP
FNSPLQERVANQRIAFPCPAKGLPKPVIRWLRNGQELTGNEPGVSILEDGTLLILAAVSP
LDNGEYLCAAINDAGSTERKYQLKVNVPPVLRDEETPGNVTLVLSQSTSLVCNVIGSPTP
VISWYKDGTLVVASNSIQILDMGKTLRLLKAATTDAGSYSCKAINIAGSTEKNFFLDVLV
PPTILGSASPQDVTAIVKQEISLECNVQGAPFPTIQWYKDRKLVFLGDPNLKVLNRGQVL
KITSARLGDKARYQCSVINSAGKQSKDFNLSVFVPPSIKGGNTTSQVTALLDTLVTLECE
ARGVPVPTITWYRSGEAIPSNRQLQYVERGHYLRIPRAQASDAGQYNCKVTSTAGSAEKS
FQLEVYLPPTIAGGDDGPTERKVVLSRPLILECEAGGHPPPSLTWLKDGVPVRDGESVRL
FEQGSRIEIISAAVSDSGRYVCVATSIAGEKEVKYDVKVLVPPFIEGADDVTDSTVIVDS
PLELECHASGTPAPQITWYKDGKAVTQGEGLRVAASGRQLVVSRAQVSDAARFQCVATNE
AGDHARDFHVVVHVPPSIRTTGPAERSVVLHQLISVECISSGIPPPSVTWLKDGRPVDTT
QGHLKLESAGRMLKVTEARQEDSGKYTCLATNAAGEAQQHIRLSVHEPPSIPHSGELRNQ
TILSGFPTELECKATGRPLPAITWYKDGRPLTSAAGLTMLKRGQVLEIERAQLSDAGLYR
CLAVNLAGVAEISHSLQVYVPPVISSRGGTVTVVVNEAARLECEATGVPLPSLTWLKDGS
PVASVSHGIQVLAAGRVLSLASALVSDTGRYTCVAVNAGGEQHREYHLRVYVPPNIEGEE
ANATVMLGRPVELHCQSDAIPPPTLSWRKDGRPLFRKPGLTVSADGSVLKVYRAQVQDSG
RYSCEATNVAGKTEKNYNLNVWGDIRGSEEVFPLTVIEGSPITLMCESSGIPPPSLIWRK
DGESILVGSELKSDQRLRVLSGGRQLQISSAERTDTASYTCTASSSAGNTSKKYSLQVHV
RPSISRSEGHTDDVTVTKGGDVTLQCAAEGVPRPAITWLKDGRPIAGQQRAVIQNEGRML
QIKDAKVSDTGRYTCIAVNVAGQADRKHDISVHVPPSIIGQVQLPENVSVVLKNPVALSC
EASGIPLPAITWLKDGRPIKATSSVRVLSGGRSLRLMHAAAEDAGRYTCIVSNSAGEERK
NFDLDVLVSPSIVDEGTVVDTKVMEKHNLTLTCEASGNPSPEIKWLKDGQLLVPDRRHQV
TSYGRFLQISGAQVADTGRYSCHASNSAGHRNRHFNLNVLVSPTITGSGPDGSAEEVTVT
LSNPTSLVCEVQSYPPALIIWLKDGTPFESNHHVRVLPGGRTLQILNAKEEDAGRYTCVA
TNEAGETVKHYEVKVYVPPQINKNDIPGEGLAPKEVKIKVNSTLTLECAAQAFPTPALQW
YKDGQILHSDDHVSITANGRIAQIKHAQVSDTGRYTCIATNIAGEDEKDFDVNIQVPPNF
NRPGAVGDTTSSPGFGGDFRNVILNNPISLYCETNAVPPPTLTWYKDGKLLTSNEKVLIL
PGGRVLQIPRSQAEDSGKYTCVAVNEAGEDSLQYDVRVLLPPTIRGTNSELPDEVTVLVN
KTTQLECHVDGNPAPKITWFKDNQPVSNDGPHRIPSNGRSLQVLTAQISDTGRYVCVADN
VAGSAEKSFNLNVHVPPTIIGVSPDSVTVVVNNFVSLSCEATGFPPPTLSWLNDRGSIQA
NSNALIMPGGRILQILKAKVSDGGKYSCVAINAAGEAHKNIHLTVFVPPSIRDRSGDSPV
VLNVLVGKSVILECESNAVPPPTITWYKNGRMVTESANLRILVERQVLEIRASEVSDTGQ
YVCKATNVAGQVDKNFHLNIHVPPSIDGPAEESVVETISNPVTFACDATGIPPPSLTWLK
DGRPIEYSESLEMHIFSGGSKLQIARSQLSDSGTYTCLASNLEGEAHKSYRLTIQVPPSI
SRSDLPGEMAVLLNESIQLDCRALGTPTPTIQWLKDGDVLNNTRDDEGLRISPDGSTLTV
TRARTTDSGKFTCVATNNAGQEDRIFNLNVYVPPVIDGNSETVAQLTTVLDSSVNIECVA
TGSPPPQLNWLRNGLPLPVSSHIRLLSAGQVLRITRSQVSDSGTYTCIASNRAGVDNRQY
NLRVHVPPGLDGAGSTEDVTVVKGNSASLLCVADGTPTPSLSWFKDGLTLIADPHLHFLN
LNTTLHIVLAQVNDTGRYTCVADNTAGQASRHFALKVLDPPHIKGSGAPAEVTVVVNNVL
ELQCEVSGIPTPFLTWLKDGRPLPQTESLSLLRGGEVLHVASAQLENTGRYSCLANSPAG
DDDREFLVRVHVPPNIAGDSTPQDVSVLQNRQVILECKSDAIPPPTLTWLKDGQQLQASS
RVRILSGARYLQINMAELSDKAQYTCVASNIAGKTTRQFNLAVNVAPIIKEGSQTVSVHI
NQPAVLECIVSGVPPPRVTWRKHGAILAGNIPGYTFAEGGSLHIHSAQVTDTGRYLCMAT
NQAGTQRKKVDLQVYVPPFIAKSRTNVTVTVNVQTTLSCEATGIPKPTVSWMKNGRAIDT
DQNQNLYRLLSSGSLIVIAPTVEDTAVYECVVSNEAGEESRSITLTVHVPPSIADEPTEL
VVTRLSPVVIACTASGVPVPTIHWTKDGMQLNKEGQGYSILPTGPVDIPSAQLSHAGRYS
CTAKNAAGSTHRHVQLTVQELPVIQDHPSTLDVILNNPITLPCRATGSPRPTITWQKEGI
NIPTTGGGFAVLPNGGLQINKASVSDSGTYICVAQNPAGTALSKTKLRVQVPPAISSTTQ
KYLSPVDSSVTLHCQSDGSPPPTVSWHKDGQPVSDSVRQRVLNSGSLQIAFIQPSDTGRY
TCTAANAAGTVSHEMSLTVQIPPSIRAGEQQVAVVENTQAQLMCVAQGVPQPSLAWEKDG
NPLSESTGEYTILPSGELVIDMAQPDDVGSYTCVATNAVGRDSRTTTLSVHTHPAFTELL
VDVTLNKGERLLLACGVNGVPPPKITWAFNNNIIPVHYDHVHGHSELVIDRVTKDDSGSY
SCVAENSVGTIKSLGFVYVKEPPIIDGDLHSNRIEPLGGNSILNCEVRGDPPPTIRWSKS
GINIQISNRIRQLDNGSLAIYGTVSEDAGNYVCVATNDAGVVERSVTLTLQSAPIIVVEP
AETVVDAGTTVVLNCQAEGEPTPKIEWSHQGRLLPSNGRFSTLSNSSLRISSAQKEDTAE
YQCVARNLLGSVVVRGTLTVRVHGGYSEWSKWGPCSVSCGFGSQKRLRQCNNPLPANGGP
HCAELDTETHGCQGKPCPVDGNWSEWSLWEECSRTCGQGNRTRVRTCSNPPAQHGGKPCE
GRAVEVIMCSVRPCPVAGNWGSWLPWSPCSETCGKGVQSRLRLCNSPPPAFDGPQCESTD
TQTQVCKERPCPVDGKWSSWVSWGACSVSCGGGTRQRTRLCASPAPQHGGRSCEGNDVLI
DFCNSDLCPSDGNWGAWSSWGSCSKTCNGGQMRRYRTCDHPRPANGGRACAGADTQIQRC
STPDCPVNGNWGSWQQWAECSSSCGGGERTRVRLCNSPSPSNVGRPCPGDSSQLARCNGH
SCPGGAQKARGSIIGNINDIEFGVAILNATISDSESGGRIIKATITNVPRTLGPAMRKLI
SILNPVYWTTAQEVGEAVNGNTLTGSVFRRETQVEFATGEILRMTHIARGLDSDGALLLD
IVVNGHILQLPSHADIRIKDYTEDYIQTGPGQLYALSTRMFSIDRESVPYSWNHTISYDP
SKGKMPYLVEALQATAISAQYHPMEEMLEYSIQASITKGDRSNQCPQGFNLVSAGPYCAD
ENECAIRNPCSHACHNAMGTYYCSCPRGLTISADGRTCQDIDECSLGGHVCHDGHDCENT
IGSYRCIMRCGRGFRRTADGLSCSDVNECQESNPCNQHCLNTIGSYRCACEPGFQIRNRR
CIDINECRQRVCRSDQQCKNTRGGYTCIDLCPNGMTKGANGTCEDVDECRDGTHQCRYNQ
ICENTRGSYHCTCPRGHRSQGVGRPCIDINECERLQQPCAHQCINTPGSFKCTCPPGRHL
LGDGKSCAGLERLPSYESYSFGYRTSESSPERSSYQRRYHNLASQSYHSYTDASRRHNKS
RRHRASPAPQGVLACQQGFESRGGSCLDVNECEVRDTCQHECMNTPGSYRCLCPAGYRLM
TNGKTCQDVDECLEQNIQCGVNQMCFNMRGSYECIDTPCPPNYKRDPTTGFCLKNCPAND
LECALSPYALEYKLLSLPFGIAANQDLIRLVAYTQDGVMHPRTTFLAVDEDVTLPFALRD
ENLKGVLFTTRALREPHTYRMKVRALSYSEAGGIEYQTTFIVYIAVSAYPY
Download sequence
Identical sequences G3NWN1
69293.ENSGACP00000009750 ENSGACP00000009750 ENSGACP00000009750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]