SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009761 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009761
Domain Number 1 Region: 54-180
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000424
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 2 Region: 1-53
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000013
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009761   Gene: ENSGACG00000007309   Transcript: ENSGACT00000009781
Sequence length 288
Comment pep:known_by_projection group:BROADS1:groupVIII:8417585:8421180:1 gene:ENSGACG00000007309 transcript:ENSGACT00000009781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
INECRQRVCRSDQQCKNTRGGYTCIDLCPNGMTKGANGTCEDVDECRDGTHQCRYNQICE
NTRGSYHCTCPRGHRSQGVGRPCIDVNECEVRDTCQHECMNTPGSYRCLCPAGYRLMTNG
KTCQDVDECLEQNIQCGVNQMCFNMRGSYECIDTPCPPNYKRDPTTGFCLKNCPANDLEC
ALSPYALEYKLLSLPFGIAANQDLIRLVAYTQDGVMHPRTTFLAVDEDVTLPFALRDENL
KGVLFTTRALREPHTYRMKVRALSYSEAGGIEYQTTFIVYIAVSAYPY
Download sequence
Identical sequences G3NWP2
ENSGACP00000009761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]