SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009810 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009810
Domain Number 1 Region: 1424-1532
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.93e-34
Family Spermadhesin, CUB domain 0.00029
Further Details:      
 
Domain Number 2 Region: 724-838
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-32
Family Spermadhesin, CUB domain 0.00067
Further Details:      
 
Domain Number 3 Region: 1770-1889
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-32
Family Spermadhesin, CUB domain 0.00067
Further Details:      
 
Domain Number 4 Region: 1947-2056
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.58e-32
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 
Domain Number 5 Region: 180-283
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.1e-30
Family Spermadhesin, CUB domain 0.00089
Further Details:      
 
Domain Number 6 Region: 4-112
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.23e-30
Family Spermadhesin, CUB domain 0.00042
Further Details:      
 
Domain Number 7 Region: 384-495
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-30
Family Spermadhesin, CUB domain 0.00065
Further Details:      
 
Domain Number 8 Region: 556-665
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.37e-30
Family Spermadhesin, CUB domain 0.0006
Further Details:      
 
Domain Number 9 Region: 1250-1358
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-28
Family Spermadhesin, CUB domain 0.00084
Further Details:      
 
Domain Number 10 Region: 1077-1186
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.9e-28
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 11 Region: 2119-2226
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-25
Family Spermadhesin, CUB domain 0.0019
Further Details:      
 
Domain Number 12 Region: 897-1018
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-25
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 
Domain Number 13 Region: 1592-1707
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-23
Family Spermadhesin, CUB domain 0.0043
Further Details:      
 
Domain Number 14 Region: 2288-2406
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.9e-23
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 
Domain Number 15 Region: 3093-3162
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.31e-19
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 16 Region: 3033-3104
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.25e-18
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 17 Region: 2677-2745
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.48e-17
Family Complement control module/SCR domain 0.00089
Further Details:      
 
Domain Number 18 Region: 2917-2984
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.37e-17
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 19 Region: 2734-2802
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.62e-16
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 20 Region: 2405-2478
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000135
Family Complement control module/SCR domain 0.00086
Further Details:      
 
Domain Number 21 Region: 2974-3044
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000681
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 22 Region: 2794-2862
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000681
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 23 Region: 1537-1600
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000135
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 24 Region: 3213-3277
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000195
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 25 Region: 321-390
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000639
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 26 Region: 2594-2650
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000792
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 27 Region: 2468-2534
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000148
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 28 Region: 1364-1429
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000167
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 29 Region: 1714-1779
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000027
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 30 Region: 845-905
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000292
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 31 Region: 117-177
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000031
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 32 Region: 1189-1254
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000347
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 33 Region: 1888-1950
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000584
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 34 Region: 499-564
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000737
Family Complement control module/SCR domain 0.00095
Further Details:      
 
Domain Number 35 Region: 2061-2129
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000135
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 36 Region: 670-733
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000195
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 37 Region: 2849-2910
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000025
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 38 Region: 3146-3207
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000417
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 39 Region: 1018-1087
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000796
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 40 Region: 2231-2295
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000364
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 41 Region: 3268-3329
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000167
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 42 Region: 2540-2605
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000299
Family Complement control module/SCR domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009810   Gene: ENSGACG00000007372   Transcript: ENSGACT00000009830
Sequence length 3574
Comment pep:known_by_projection group:BROADS1:groupX:10807926:10961030:-1 gene:ENSGACG00000007372 transcript:ENSGACT00000009830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAQNCSYTLHSPNGTIESPGYPYGYPNYANCTWVIVAAEHNRIQLVFQGFALEEDFDILS
VYDGPPSPGNLRTRLTGFQLPSPIVSTGSRLTLWLLSDYAVSGQGFKAAYEALPSYTCGN
PGQLLNGHQQGSTFNIGDKIRYSCSPGYVLEGHTTLSCLATSAGTAAWDFPLPYCRADDG
CGGTLRGQSGVITTPNYPADYNNNADCTWTVLAEPGDTIALVFSDFQLEDDYDLLEVSGT
EGSSQWFTGPNLPSPIISSKNWLRLHFTSDGNHKLRGFSAQYQVKKMTELKSRGVKMLPS
KDNHHKISVLSQMGVAQGHNMCPDPGIPDRGKRKGTDFRRGATVHFSCDEGYELQGSKSI
SCLRVTDSYVGWSDDRPICRAPMCGGQLKGPSGVITSPNYPVQYDNNANCTWLITATDTS
KVIKLTFEDFDLERGYDTLTVGDGEVVGDQKTIFHVLSGTTTPDLVVSTSNLMWLNFKTD
DTSGSLGFKVSYEEIDQGSCGDPGIPAYGKREGTSFRHGERLYFECLPAFELVGKKNITC
QKNNQWSAKKPSCVFSCFFNFTTPSGVLLSPNYPQEYGNNMHCVWLIITNPESRINLAFN
DLSMEKQFDFLSIKDGGKAESPILGTYSGAALPPPITTSAHVARLEFLTDHTYTDRGFNI
TFTTFRHNECPDPGVPVNGKRFGESLQLGSSISFLCEEGFVKTHGSQTISCILKDGNVVW
DNAVPRCEAPCGGDLKAPSGIILSPGWPELYKEALNCEWIIEAPPGYPIKIIFDKFRTEV
NYDVLEVRDGRFPSSPLIGSYQGTQVPQFVISTSSFLYLLFSTDKSHSDIGFRIRYETLQ
LQSDHCVDPGIPVNGQRHGNDFYVGALVTFSCDAGYTLSDTEPLECEPNFQWSRPLPSCD
ALCGGYIQGNFGTILSPGFPDFYPHNLNCTWIIETSHGKGVQFNFHTFHLESPHDHLVVT
ENGSFSQPLWRLTGSTLPLPLSAGLFGNYTAQIRFLSDFSVSYEGFNITFSEYDLEPCED
PGIPPYSARKGLHYGVGDSLIFSCFPGYRLEGPARVICLGGRRRVWSSPLPRCVVAECGS
SVTGMQGVLLSPNYPGYYGNNHECIYSIQTQPGKGIQLRARDFRLEEDDVLKVFDGSSNE
ARLLGVFTGSEMLETTLNSTSSSMWLEFISNAENTSKGFELHFISFELVKCEDPGVPQFG
YKREDKGHFAGSSVSYSCDPGYTLKGPQVLTCLRGERRAWGSPLPLCVAECGGTIKDEPS
GRILSPGYPAPYEHNLHCMWTIEAAPGSTISLHFLVYHTEEVHDVLRIWDGPQEGGVLLR
ELSGSMLPPDAHSTFNTVSLQFTTDFFTSKQGFALQFSVSTATSCNDPGMPTNGTRGGDS
REPGDHVVFQCDPGYILQGANRITCAEINGRFFWQPDPPTCTAPCGGNLTGPSGLILSPD
YPEPYPHGRECDWTVTVTLDYVIALSFNQFSLEPSYDFLHIYDGPDSLSPLLGSFYGTDF
PDRIESSSNTLFLAFRSDASLSSNGFVLQYTENPRESCFEPGVVRNGTRVGADLKLGSTV
AYRCDSGYTLEGDPTLTCIMGGDGKPSWNKPKPICIAPCGGQNSGLEGVVLSPGYPGNYS
SARTCLYSVVVPKDYVVFSQFTFFHTALNDIVEVYDGATQHSRVLSSLSGAHTGESLPLA
TSNQVLIRFTSKGQSSSRGFHLVYQAVPRTSATQCSSVPEPRNGRRMGNNFAVGAVIRFE
CSPGYVLEGPSAIECLTVPNALAQWNSSIPSCIVPCGGNLTQRTGTILSPGFPEPYLNSL
NCVWKITVPEGSGVQIQVISFVTEQNWDSLEVFDGGDNTDTMLGSFSGTTVPALLNSTSN
QLYLHFFSDISVSAAGFRLEYKTVSLTSCAEPVVPMNSIKVGERLQMNNVVSFQCEPGYT
LQGNSHITCMPGTFRRWNYPPPLCIAQCGGIREEMEGMILSPGFPGNYPSNADCTWRIYL
PVGYGANLQFLNFSTEANHDFLEIRNGPLDTSAVIGRFSGQDIPPSVFSTSHETTVYFHS
DHSQNKPGFRFEYQAYELQECPDPEPFRYGAVVGAGFNVGQSISFECLPGYQLMGYSILT
CEHGTTRNWDQPFPRCEVPCGGNITSDNGTIFSPGYPEEYPSSADCSWLITVAHGFGIKI
NFTLLQIHGPHNFITVWDGPQETARKLGVFTDGEPNDPPSSTSNQVLIRFRSNTEKGGLF
RISYQAYRLQFCLPPPIIPNAEILMASKEFKIGDIVRYRCLPGYQLNGNSILTCRLGTHL
EFEGPPPSCDVTCPMNEVLTASTGVIMSQSPGNGFPHFDSCSWVVKVEPGYNITFTIEHF
QTSRQFDELEIFDGPSRQSPLLITLSGNYSNPLSITSSSNRVYLHWSFDHTTRHKGFRIR
YSVAYCSPHNNPANGTVHSLTGTKLGSTLRFSCDQGFRLIGQSSATCTRTAQGIYQWNAP
VPLCQVTSCGMPVPPVNGSIGGQDFSLGARATYQCNPGFRLTGPITTSVTCQESGRWSPI
EAPPRCVPVTCPDIGHSAVEHGRWRLIYGTQNQYDTLMMLICDPGYYYRGQRVIRCQANS
TWNYPDPRPVCEIISCGDLGTPPNGNKIGTLTVYGATAIFSCNTGYTLVGSRVRECMSNG
LWSGTQVQCLGETLSTQRRVTVIQRLTFTVFSSSAGHCGTPEPIVNGQINGENYNYRGSV
VYQCNPGFRLIGVSVRICEQDHRWSGRTPVCVPITCGHPGNPTFGMTQGTQFNLNDAVRF
VCNTGYVLQGAVKSACQANGQWSNALPRCKIVNCTEPGHVENSIRQILPSGPHRYSFQTT
VSYRCNPGYYLLGTSSISCQGDGTWDRSLPKCLLVLCDRPSMPPYAQISGDRRTVGSVIR
YSCIGQRTIVGNTTRMCQLDGQWSGSPPHCSGDAAGLCGDPGTPVHGIRLGEEFTVGAAV
RFSCEPGYLLKGSPERTCLANGSWLGTQAECHVISCGNPGTPRNAQILNHDGLTFSRSIT
YACREGYYSTGLLTRHCTVNGSWTGNMPECSVINCGDPGVPANGLRLGNDFIYNLTVSFQ
CSPGFTMDADRASTLICTKDRTWNGTKPHCKAIVCGPPPIIPNGQVVGTDFTWGSSISYS
CNQGYQLSLPTVLTCQGNGNWSGEKPQCFPVFCGDPGMPAQGRREDRGFTYLSSVSFSCY
SPLILVGSTRRYCQYDGTWSGTQPSCIDPTHTTCGDPGTPLFGNQNNSQGFQISSTVFFS
CRKGYLLQGSITRTCLPNLTWSGFQPECIAHHCSQPELQAQSDVRAIELPSLGYTLIYTC
QPGFYLAGGSEHRTCRSDGSWTGKPPLCAADNRPSGKSPVGTVQEPPSKLPVPAGVFSKN
SLWRGSYEYLGKKQPAMLSITAFEPFSNRVNATLIDHSGVELKLAGIYKKEEAQLLLQVH
QIRGPVEIFVNKFKIDNWALEGHVSYISSSNSFVYQGFVRGKGFSQFGLQRLACMALDSL
KSLKDNTGYNFASNSSSVAAAILVPFIAMIIAGFALYLYKHRRRPKVPFNGYVGHENTNG
RATFENPMYDRNIQPTDIMASETEFTVSTVCTAV
Download sequence
Identical sequences G3NWU1
ENSGACP00000009810 ENSGACP00000009810 69293.ENSGACP00000009810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]