SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009815 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009815
Domain Number 1 Region: 421-490
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.75e-19
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 2 Region: 5-73
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.7e-18
Family Complement control module/SCR domain 0.00089
Further Details:      
 
Domain Number 3 Region: 245-312
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.35e-17
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 4 Region: 62-130
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.2e-17
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 5 Region: 361-426
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.36e-16
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 6 Region: 122-190
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000131
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 7 Region: 541-605
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000375
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 8 Region: 299-359
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000089
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 9 Region: 177-238
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000459
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 10 Region: 474-535
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000082
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 11 Region: 596-657
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000324
Family Complement control module/SCR domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009815   Gene: ENSGACG00000007372   Transcript: ENSGACT00000009835
Sequence length 875
Comment pep:known_by_projection group:BROADS1:groupX:10807926:10825469:-1 gene:ENSGACG00000007372 transcript:ENSGACT00000009835 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSAGHCGTPEPIVNGQINGENYNYRGSVVYQCNPGFRLIGVSVRICEQDHRWSGRTPVCV
PITCGHPGNPTFGMTQGTQFNLNDAVRFVCNTGYVLQGAVKSACQANGQWSNALPRCKIV
NCTEPGHVENSIRQILPSGPHRYSFQTTVSYRCNPGYYLLGTSSISCQGDGTWDRSLPKC
LLVLCDRPSMPPYAQISGDRRTVGSVIRYSCIGQRTIVGNTTRMCQLDGQWSGSPPHCSG
DAAGLCGDPGTPVHGIRLGEEFTVGAAVRFSCEPGYLLKGSPERTCLANGSWLGTQAECH
VISCGNPGTPRNAQILNHDGLTFSRSITYACREGYYSTGLLTRHCTVNGSWTGNMPECSV
INCGDPGVPANGLRLGNDFIYNLTVSFQCSPGFTMDADRASTLICTKDRTWNGTKPHCKA
IVCGPPPIIPNGQVVGTDFTWGSSISYSCNQGYQLSLPTVLTCQGNGNWSGEKPQCFPVF
CGDPGMPAQGRREDRGFTYLSSVSFSCYSPLILVGSTRRYCQYDGTWSGTQPSCIDPTHT
TCGDPGTPLFGNQNNSQGFQISSTVFFSCRKGYLLQGSITRTCLPNLTWSGFQPECIAHH
CSQPELQAQSDVRAIELPSLGYTLIYTCQPGFYLAGGSEHRTCRSDGSWTGKPPLCAVPA
GVFSKNSLWRGSYEYLGKKQPAMLSITAFEPFSNRVNATLIDHSGVELKLAGIYKKEEAQ
LLLQVHQIRGPVEIFVNKFKIDNWALEGHVSYISSSNSFVYQGFVRGKGFSQFGLQRLES
LDSSKDNTGYNFASNSSSVAAAILVPFIAMIIAGFALYLYKHRRRPKVPFNGYVGHENTN
GRATFENPMYDRNIQPTDIMASETEFTVSTVCTAV
Download sequence
Identical sequences G3NWU6
ENSGACP00000009815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]