SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009898 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009898
Domain Number 1 Region: 27-208,289-450
Classification Level Classification E-value
Superfamily L domain-like 2.49e-60
Family Ngr ectodomain-like 0.00038
Further Details:      
 
Domain Number 2 Region: 507-668,724-869
Classification Level Classification E-value
Superfamily L domain-like 3.69e-50
Family Ngr ectodomain-like 0.000044
Further Details:      
 
Domain Number 3 Region: 1143-1332
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-43
Family Laminin G-like module 0.0047
Further Details:      
 
Domain Number 4 Region: 914-955
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000551
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 5 Region: 994-1034
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000472
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 6 Region: 957-1001
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000623
Family EGF-type module 0.013
Further Details:      
 
Domain Number 7 Region: 1332-1367
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000205
Family EGF-type module 0.024
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000009898
Domain Number - Region: 1037-1074
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000115
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 1371-1407
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000264
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 1417-1447
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000812
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009898   Gene: ENSGACG00000007441   Transcript: ENSGACT00000009920
Sequence length 1527
Comment pep:known_by_projection group:BROADS1:groupVI:8626342:8699058:1 gene:ENSGACG00000007441 transcript:ENSGACT00000009920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGRRAGLWMWVVMLSALLVGNVSACPALCTCSGTTVDCHGLGLKTMPRNIPRTTERLELN
GNNLTRITKSDFAGLKYIRVLQLMENQITAIERGAFDDMKELERLRLNRNQLQQLPELLF
QKNPALSRLDLSENFIQSIPRKAFRGATDIKNLQLDKNHISCIEDGGFRALRGLEVLTLN
NNNISSIPVSSFNHMPKLRTFRLHSNNLNCDCHLAWLAQWLRQRPTIGLFTQCTAPSELR
GLNVAEVQKHEFSCSGHQEPGSPQPCSVGVGSCPAMCTCSNNIVDCRGKGLTAIPANLPD
TMAEIRLEQNGIKSVPPGAFSPYKKLRRIDLSNNHISEIAPDAFQGLRSLNSLVLYGNKI
TDLPKGVFDGLYALQLLLLNANKIHCVRANAFQDLQNLSLLSLYDNKIQTLAKGTFASLR
AIQTLHLAQNPFICDCNLKWLADYLRSNPIETSGARCASPRRLANKRIGQIKSKKFRCSA
KEQYFIPGTEDTRLNNACNSDPVCPPKCRCESNVVDCSNLKLTKIPEHIPTSTSELRLNN
NDITALEATGVFKSLSQLKKINLSNNKITEIEDGSFEGASAVNELHLTANQIDSVRSGMF
RGLEGLRMLMLRNNKISCVHNDSFTGLHNVRLLSLYDNQLTTITPGAFDTLQTLSTLNLL
ANSFNCDCRLGWLGDWLRSRKIVTGNPRCQRPAFLKEIPLQDVALPDFRCEEGQEEPSSC
VPRPQCPSECTCLETVVRCSNKHLHTLPKGIPRNVTELYLDGNQFNVVPKELSTYKYLQL
VDLSNNKINSLTNSSFANMSQLTTLILSYNSLRCIPKMAFSGLHSLRLLSLHGNEISELP
DGIFNDVASLSHLAIGANPLHCDCHLRWLSDWVKTSYKEPGIARCAGPQGMEGKLLLTTP
AKKFECTGDVDTTVVAKCNPCVSSPCLNHGICHSDMVEIYRCSCPPGFKGKNCETALDAC
LSSPCANRGTCQVNDGEEGQYSCTCPLGFEGPTCQTNIDECEDNDCENGATCLDGVNNYT
CFCPPYYTGEMCEEMEDVCAPGRSPCKHQSTCLITSNGPKCVCSPGYVGDDCSVDYKECE
EHRCQNGAQCAPFHLLHHQRRPLSLGLRSGQLCEFLPYALSLCELADCQNNAPCLERGGR
ALCQCPPEFGGPRCEKLVSVNFIDRDSYLLLSDLKNWPQANITLQVSTAEDNGILLYNGD
NDHIAVELYQGHVKVSYDPGSQPGHAIYSSTETINDGQFHTVELVTFDQMVNLSIDGGLP
TTMDSFGAVRPLNGEAPLYVGGMPVAVHSGAFRLWQLQNGSSFHGCIQNLYINNELQDFT
KTQMKPGVVPGCEPCKKIYCVHGICQPDGFQGPVCHCQPGWTGPQCDQTATNPCQGTKCV
HGKCIPLDPQSYRCECEEGYRGALCNQQGELFNPCRRLSCKHGRCQISDTGEAYCHCESG
YTGGLCDAESECRGEPVRDFYQVQRGYAICQTTRMVSWVECSGACDAGACCASQRMKRRK
YTFECSDGTSFSEEVEKTIKCGCVGCM
Download sequence
Identical sequences G3NX29
ENSGACP00000009898 ENSGACP00000009898 69293.ENSGACP00000009898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]