SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009994 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009994
Domain Number 1 Region: 711-840
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000424
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 2 Region: 355-397
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000117
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 3 Region: 609-652
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000227
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 4 Region: 431-550
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000392
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 5 Region: 647-689
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000639
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 6 Region: 319-355
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000731
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 7 Region: 393-436
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000178
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 8 Region: 278-323
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000286
Family EGF-type module 0.02
Further Details:      
 
Domain Number 9 Region: 832-885
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000513
Family VWC domain 0.07
Further Details:      
 
Domain Number 10 Region: 573-609
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000668
Family EGF-type module 0.026
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000009994
Domain Number - Region: 167-321
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0345
Family Growth factor receptor domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009994   Gene: ENSGACG00000007522   Transcript: ENSGACT00000010016
Sequence length 1102
Comment pep:known_by_projection group:BROADS1:groupXVIII:6376685:6408243:-1 gene:ENSGACG00000007522 transcript:ENSGACT00000010016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KVSQSTGYFELQLITVANVNGELADGDCCDGPRSSSDLRCTRDECDTYFKICLKEFQMEV
STGGACTFGDGSTQVLGGNTFSFKSTTSNPNKIDEAGKILIPFQFAWPRMYTLIVEARDW
DNTTRNIGDELLIERSIHTGMINPGDQWQTILHDGPVARLVYRIRVRCNDNYYSNKCNKL
CVPRDDYFGHYRCEPSGARVCLDGWMGSDCRKAICKQGCNLLHGNCSVPGECKCNYGWQG
QFCDECVLYPGCVHGTCNSKWQCNCERNWGGLLCDKDLNYCGRHQPCVNGGTCMNTEPDE
FHCACPPGYSGKTCQIADHACVSNPCANGGRCHEVPSGFECQCPPGWEGPTCADNLDECA
SGPCAKGGTCIDLEDGFECVCPPQWEGKTCQIDANECAGKPCVNAFACKNFIGGYYCNCF
RGWSGQNCDINLNGCHGQCQNGGTCKEDQRGHHCQCPPGFVGSHCEIRKNKCDSSPCQNA
GQCHAVLDGFVCQCPPQFAGQLCEADVDACDPNPCENEAECYSMDEDFYCACPEGFEGKT
CERLKENCQTAPCQVIDSCTIAVATNDSAGVRHISSNVCGPQGRCISQPEGNFTCMCDLG
FSGIYCHENINDCIDNRCGNGGTCIDGVNSFQCFCPDGWEGQLCDLNVDECRHNPCKNGG
RCVDLVNDFYCQCADSWKGKTCHSRESQCDATTCSNGGTCYDHGDAFRCACPPGWGGNTC
NTARNSTCASGPCSNGGTCVGGGDTFTCICKEGWEGPTCGQNINDCSPHPCYNGGICVDG
VNWFRCECAPGFAGPDCRININECQSSPCAYGATCVDEINGFRCICPLGRTGARCQECFG
RTCHYAGLQFPHGSQWEEECNSCHCINGKADCTKVLCGRRSCVLPSSAQDPKQQTCPAGQ
ECLEHRYLTCFSPPCQQWGVCSRAGPSSPEASTKCQPNTGHLDNSCGRITLVFNRDKVPQ
GTTVQNICYELRYLPDTRSLAKDHALLLLCALSHSNQDAVEVAISFQPEDLPDHSLIQQA
ASAIVGTLSKRHNSTIMLAVVEVKVETQVMAPSVVDYRVPLLCVLFCLLCLFCIIVCVWW
TRKRRKERERNSRPAADDNVNN
Download sequence
Identical sequences G3NXC5
ENSGACP00000009994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]