SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009996 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009996
Domain Number 1 Region: 332-397
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000502
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 2 Region: 815-863
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000212
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 3 Region: 506-547
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000753
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 4 Region: 923-973
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000201
Family Laminin-type module 0.064
Further Details:      
 
Domain Number 5 Region: 767-808
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000307
Family Laminin-type module 0.0098
Further Details:      
 
Domain Number 6 Region: 971-1020
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000067
Family Laminin-type module 0.0022
Further Details:      
 
Domain Number 7 Region: 268-334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000809
Family Laminin-type module 0.049
Further Details:      
 
Domain Number 8 Region: 454-498
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000117
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 9 Region: 861-914
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000137
Family Laminin-type module 0.0046
Further Details:      
 
Domain Number 10 Region: 1080-1121
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000279
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 11 Region: 1023-1077
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000474
Family Laminin-type module 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000009996
Domain Number - Region: 395-445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000106
Family Laminin-type module 0.032
Further Details:      
 
Domain Number - Region: 1128-1175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000335
Family Laminin-type module 0.01
Further Details:      
 
Domain Number - Region: 1240-1399
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.000536
Family C-terminal domain of PLC-beta 0.012
Further Details:      
 
Domain Number - Region: 85-162
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00156
Family beta-mannanase CBM 0.065
Further Details:      
 
Domain Number - Region: 1558-1772
Classification Level Classification E-value
Superfamily Tropomyosin 0.00543
Family Tropomyosin 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009996   Gene: ENSGACG00000007525   Transcript: ENSGACT00000010018
Sequence length 1785
Comment pep:known_by_projection group:BROADS1:groupXIX:8703811:8725426:1 gene:ENSGACG00000007525 transcript:ENSGACT00000010018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCLYLLFLSFLFSYFISSLPEFTDVCTEGSCYPATGDLLIGRAHQLSSTSTCGLNHPEPF
CIVSHLQEEKKCFLCDSSTPYDELSSPTRGHRIENVVTTFAPNRLKTWWQSENGLENVTL
QLDLEAEFHFTHLIMTFKTFRPAAMLIERSADFGKKWQLYRYFAYDCESAFPSVSQGPMQ
KVDDVICDSRYSDIEPSTEGEVIFRVLDPVFRIEDPYSPRIQNMLKITNLRVKFTRLHTL
GDNLLDSRMEIKEKYYYAIFDMVVRGNCFCYGHAAECAPVQGAGQTSEGMVHGHCMCNHN
TKGLNCEKCLDFYHDLPWRPAEGRNTNACKKCNCNHHTSSCHFDMAVFVASGNRSGGVCD
DCQHNTAGHNCERCKPFYFQHPERDARDPNICQPCNCDSVGSLNGGLCDGVTDVRVGLIT
GQCRCKVNVEGERCERCKQAHYGMGPEPEGCKACTCSPLGTLAGGNPCDSETGSCFCKRL
AMGRDCDQCVAEHWGLSNDMDGCRPCDCDFGGAINNQCDQVSGQCVCRDHMFGRRCDQVE
SGFYFIALDHYTYEAEDAKFGPGVTVVPRPHPLDRNPTWTGIGLVNVPEGAFLEFSVDNI
PHSMEYNILIRYEPQLPDQWEEVLMTVMRPGPIRADSRCVNTVPDDDHQMISLHPGSRYA
SLARPVCFESGLNYTIRLSLPLYSALSDVQSPYTLIDSIVLMPHCKNLEIFSTSEGGDSS
GNSAWETFQRYRCLENSQSVTRSPMTDICRNFIFSISAMLHQGARECHCDPQGSLSTVCD
PSGGQCECRSNVVGRNCDRCAPGTFEFGPNGCRACSCHPQGSQSLFCSELTGKCVCVFGA
YGRQCDRCLPGHWGFPNCRPCTCNGHTDDCDPDTGRCIDCRDHSTGHACESRCLDGYYGD
PLLGSGDHCRPCMCPDGPGSLRQFAGSCYVGDDTQQAVCVCNNGYRGSRCDECSPGYYGN
PGDMGGQCQPCQCNSNIDMLDPESCDSRTGECLRCLYHSEGYACQSCKHGYYGNALLQDC
RKCVCNQLGSDSSTCPSSGDCHCDRSSGQCHCLPNVVGQHCDLCAPDTWNMASGSGCEAC
ACDPKHSYGTSCNEISGQCSCQPGFGGRTCSECRELFWGEPEVKCHACDCDPRGISQQQC
NKASGHCVCVEGVSGPRCDVCSRGFSGTFPNCQRCHQCFTEWDDVIGQLTNQTHRLVNKV
NAMKASGVSGPYKKSIDSMERSVADIWVVLNQNPASQPLSETQELLQQASDLMGTLSQML
NHTERTLVQVEDQDSVVETKLDSVMSDAQKLERTVKELMDQVEFIKNSDIRGATDSITRY
FRQSLAAEVGANASTIDPGSPVETSITLRQLTEAKLNQTREEFLRKHTEHARRLDDLAGE
LQTLDLAEISHKTCGSPSSGQDSCMSSPCGGLGCVDSEGQTRCGGEGCDGVITVASNILK
NTQDSEQEIISALQEVEKLSQMVSEAKVKADEAKLSAQEVLMKSNRTKQKVLQSNEELRV
LIRQIRDFLTQDGADLESIELVANEVLAMQMPTTPAQLQNLTEDIRQKVGELGHVEDILQ
QSAADIQRAENLLDQARLASEEAADVKDSAEKVKQALEEAQKAQTTASSAIEQAAADIQN
TNQLLSSVELETSHAELKLTNSTQRLQRLEKDVSLLRDKSLNISLSTERTNQDAASISKV
AEEVKEDLDSELKEKYAKVEQMIGQKAGDVVNAKKRAESLQQEAKELLLKASDKLQLLKD
LEKSYEDNQRTLEVKAEKLVKLEAAVKELLQEISSKVTIYSTCLF
Download sequence
Identical sequences G3NXC7
69293.ENSGACP00000009996 ENSGACP00000009996 ENSGACP00000009996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]