SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009997 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009997
Domain Number 1 Region: 1-334
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.69e-104
Family Motor proteins 0.00000171
Further Details:      
 
Domain Number 2 Region: 530-613
Classification Level Classification E-value
Superfamily RuvA domain 2-like 1.33e-20
Family ComEA-like 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009997   Gene: ENSGACG00000007521   Transcript: ENSGACT00000010019
Sequence length 625
Comment pep:known_by_projection group:BROADS1:groupV:9574102:9580763:-1 gene:ENSGACG00000007521 transcript:ENSGACT00000010019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRVRVAVRLRPYMGGEDEKDEGPCVRGLDSQNLEIVNWRNATETVKYHFDVFHDEKTTQQ
EVFLSSVKPILPHILTGQNASVFAYGPTGAGKTHTMMGSSDQPGVIPRAVREVFKLVKVK
ADEEGWDYSIGMSYLEIYNEKVLDLLSPSSQDLPIRENKDKNIFIPGLTHTTISCFSDFD
KQFVPASLNRTTASTKLNQRSSRSHAILLIKVVRTQRAAPHRKQTGKLYLIDLAGSEDNR
RTGNQGIRLKESGAINLSLFTLNKVVDSLNSSAAVRVPYRDSKLTRLLQDSLGGSSHSVM
ITNIAPEYKYYFDTFGALNFASKSKLVVNKPFTCETVAVPAMPVKRARDDHTAGGSGTEP
HKKKQKDERKTEQDCSSPSSSFDSLSEPSVMDRLIALEKLMMNCQDKDKLSMLKDVAQSR
KEIQELKEKQKEFENKAMLFRRLDGEKSSAKHEPSFKDNTAPLQRKQSAATKANKQQAVV
QPLQDSLSVSQLQPLQQLAVVKKTSVCVKKKVKTISDQVEPPDGKENLVETGWEFKLDTS
VLEQSRQKILHVLNTGSLKELKGLQQIGDKKAKLILGWREIHGHFLKLEDVLTIEGMTAK
RFSTFMKANILSAMGKNWKEKCGAS
Download sequence
Identical sequences G3NXC8
ENSGACP00000009997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]