SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010016 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010016
Domain Number 1 Region: 394-659
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-54
Family YWTD domain 0.00000214
Further Details:      
 
Domain Number 2 Region: 307-386,660-703
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000447
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 42-85
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000196
Family LDL receptor-like module 0.00067
Further Details:      
 
Domain Number 4 Region: 6-44
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 5 Region: 125-159
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.00031
Further Details:      
 
Domain Number 6 Region: 167-200
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 7 Region: 84-123
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 263-297
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000393
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 9 Region: 234-259
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000497
Family LDL receptor-like module 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010016   Gene: ENSGACG00000007503   Transcript: ENSGACT00000010038
Sequence length 705
Comment pep:known_by_projection group:BROADS1:groupXVI:14620112:14642849:-1 gene:ENSGACG00000007503 transcript:ENSGACT00000010038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GASEPQRCKSDEFLCHNQRCIRALWKCDGDDDCLDGSDEESHGCYNHTCPVDQFKCSNNR
CIPKRWLCDGTNDCGNNEDEANATCSAQPCQADQFSCQNGRCIPRAWNCDREEDCGDNDE
VGCSRSCANTQFQCTSGRCIPDHWACDGDNDCGDFSDENVTCRGGSAQEFHCVTDGTCIP
ERWRCDGDKDCEDGTDEKGCEGTKRMCDPKAKFTCKDTDCETVSFNDCYTSFSTGKCITK
SWVCDGDIDCEDRSDEESCESAVCKPPKYPCANDTSACLTPDKICNGKVDCADRSDEGPI
CGMFVTTHMCLAARGGCSHQCTVAPGKGVVCFCPPGLHLDSSNKTCEAVDYCSSHLKCSQ
VCEQYKTTVKCSCYPGWTLDPDGDSCHSTDPFEAFIIFSIRHEIRRIDLHKRDYSLLVPG
LRNTIALDFHFNHSLLYWTDVVEDKIYRGRLAESGGVTGIEVVVQHGLATPEGLAVDWIT
GKLYWIDSNLDQIEVAKLNGDMRTTLIAGGMEHPRAIALDPGQGILFWTDWDATYPRIEA
ASMSGGGRHIVFKDMEIGAWPNGLTLDHLEKRIVWTDARSDAIYSALYDGSGVIEILRGH
EYLSHPFAVSLFGGNVYWTDWRTNTLARANKWTGQNVTVIQKTSAQPFDLQIFHPSRQPQ
APNPCGDNDGRGPCSHLCLINYNRTSSCTCPHLMKLSANKQSCFG
Download sequence
Identical sequences G3NXE7
ENSGACP00000010016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]