SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010064 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010064
Domain Number 1 Region: 25-287
Classification Level Classification E-value
Superfamily DNase I-like 7.07e-37
Family DNase I-like 0.000000674
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010064   Gene: ENSGACG00000007575   Transcript: ENSGACT00000010086
Sequence length 306
Comment pep:known_by_projection group:BROADS1:groupXII:9975303:9978617:-1 gene:ENSGACG00000007575 transcript:ENSGACT00000010086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVELYMFWILLFAVGLCVFNAASSLKICAFNVQSFGESKANNKKVMGILLKILSRCDVCL
IQEVRDSKGAAIQALLKDLNGRLDKSNSYSYVESERLGRKSYKEQYVYIYRSNVLTVKEH
YQYSKPEGEGTNDTDVFSREPFVVRFHSPTTLVKDFVLIGHHACPRNAMKEINELYTVFK
SIYNKWKIDNVVILGDLNAGCSYVTIKGWRAVRLRSDPKFRWLIGDEQDTTVREKTHCAY
DRIIVHGREVISSVVPGSAQPFNFKKHFHLTEEEALEVSDHFPVEVDETTCSKRRGLHRT
LFLSEK
Download sequence
Identical sequences G3NXJ5
ENSGACP00000010064 ENSGACP00000010064 69293.ENSGACP00000010064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]