SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010072 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010072
Domain Number 1 Region: 1-265
Classification Level Classification E-value
Superfamily DNase I-like 9.16e-38
Family DNase I-like 0.000000648
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010072   Gene: ENSGACG00000007575   Transcript: ENSGACT00000010094
Sequence length 281
Comment pep:known_by_projection group:BROADS1:groupXII:9975628:9977674:-1 gene:ENSGACG00000007575 transcript:ENSGACT00000010094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKICAFNVQSFGESKANNKKVMGILLKILSRCDVCLIQEVRDSKGAAIQALLKDLNGRLD
KSNSYSYVESERLGRKSYKEQYVYIYRSNVLTVKEHYQYSKPEGEGTNDTDVFSREPFVV
RFHSPTTLVKDFVLIGHHACPRNAMKEINELYTVFKSIYNKWKIDNVVILGDLNAGCSYV
TIKGWRAVRLRSDPKFRWLIGDEQDTTVREKTHCAYDRIIVHGREVISSVVPGSAQPFNF
KKHFHLTEEEALEVSDHFPVEVDLKPNHRYLLRIRQQQQHG
Download sequence
Identical sequences G3NXK3
ENSGACP00000010072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]