SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010269 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGACP00000010269
Domain Number - Region: 9-51
Classification Level Classification E-value
Superfamily SRP19 0.00458
Family SRP19 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010269   Gene: ENSGACG00000007748   Transcript: ENSGACT00000010291
Sequence length 66
Comment pep:novel group:BROADS1:groupV:9673686:9677444:1 gene:ENSGACG00000007748 transcript:ENSGACT00000010291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGNPPEKRFKNKRKGNRGRTFSQNGCTNNPNTEVFTLILSQYSLKVLFVYKQLGGAHEAV
AFSMIK
Download sequence
Identical sequences G3NY49
ENSGACP00000010269 69293.ENSGACP00000010269 ENSGACP00000010269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]