SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010341 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010341
Domain Number 1 Region: 396-721
Classification Level Classification E-value
Superfamily DNase I-like 1.1e-53
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.00011
Further Details:      
 
Domain Number 2 Region: 21-119
Classification Level Classification E-value
Superfamily SH2 domain 2.56e-28
Family SH2 domain 0.00013
Further Details:      
 
Domain Number 3 Region: 1166-1226
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000216
Family SAM (sterile alpha motif) domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010341   Gene: ENSGACG00000007795   Transcript: ENSGACT00000010363
Sequence length 1228
Comment pep:known_by_projection group:BROADS1:groupI:6212467:6229609:-1 gene:ENSGACG00000007795 transcript:ENSGACT00000010363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAMAGGGGGGGVSPLGPAPPTWYHRDLSRAAAEELLARAGRDGSFLVRDSESVNGAYALC
VLFQKHVHTYRILPDDEGFLAVQTSQGVQPKRFKTLLELVSLYLQPSQGLVTTLLYAVER
EETAVSDDRDYSDGEDEKPPLPPRSVSSCPPPGPDTPTESAPAANGLSTISHEYLKGSYA
LDLEAVKQGACSLPHLNKTLLASCKGLNGEVDKVLSGLEILSKVFDQQSSFMVSKMIQQV
RSVNQGGDQALENLVTKLAILKDLLSSIEKKALKTLQDLSLSPCSLPPLSMRHSKAIPVQ
AFEVKLDVYLAELTKIGKSQKYTLSVDVEGGRLVVMKKVKDSQEDWTTFTHDKIRQLIKS
QRVQNKLGIVFEKEKDKNQRKDFIFASAKKREAFCQLLQLMKNKHSNQDEPDMISIFIGS
WNMGSVPAPKSQASWVLCRGLGKTLDEITVTIPHDLYVFGSQENSVCDREWVESLRAMLK
EQTELDYKPIAVQTLWNIKIAVLVKPEHENRISHVGMSSVKTGIANTLGNKGAVGVSFMF
NGTSFGFVNCHLTSGNEKIARRNQNYLDILRLLSLGDKQLSSFDISLRFTHLFWLGDLNY
RLDMDIQQEILNYINRKEFEPLLKVDQLNLEREKNKVFLRFGEEEISFPPTYRYERGSRD
TYVWQKQKATGMRTNVPSWCDRILWKSYPETHIVCNSYGCTDDIVTSDHSPVFGTFEVGV
TSQFVSKKGLPKTSEQAYIEFESIEAIVKTASRTKFFIEFYSTCLEEFKKSYENDSQSSD
NVNFLRVGWSNKQLTTLKPLLSDIEYLQDQHLLLTVKSLDGYESYGECVLALKSMIGSTA
QQFHTYLSHRGEETGNIRGSMRVRVPSERMGTRERLYEWISVDKDETGGPKGKSTLVSKV
GHEYAACSSKTAWRAREKISTEHLCENHETQKPSYRPPVPPKQEAPDGDPSICKNSYNNP
AYYILEGVPNHSAAPLSPELLSSPTSPNTQVAKAPPPPSAGARTKPSYAASGPLTVGSTL
NRPPPDFPPPPLPKGALEMGAECPFSKPRSIYPDLAEVRIPAASHAAPPGLGEGGGGAGG
GGGGGAGPLDDQSCSVLQMAKTLSESEFPGQPARAPSAPPPLRGQPMGLGLDACRTFPPR
NAITESIAEDVPEEALWGSSSSSLSVGESSVGEWLQRLGLERYEPGLLHNGWDDLEFLSD
ITEEDLEEAGVFDPAHMQILLESLKQQQ
Download sequence
Identical sequences G3NYC1
ENSGACP00000010341 ENSGACP00000010341 69293.ENSGACP00000010341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]