SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010402 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010402
Domain Number 1 Region: 12-75
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000189
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 2 Region: 79-140
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000709
Family Complement control module/SCR domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010402   Gene: ENSGACG00000007847   Transcript: ENSGACT00000010424
Sequence length 350
Comment pep:known_by_projection group:BROADS1:groupXVIII:6677639:6681515:-1 gene:ENSGACG00000007847 transcript:ENSGACT00000010424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAFLPTDGASGCARPPGVQHGDLLNQTEANRGSFPPGTLLTYGCESGYTADGTTSIICTS
SGAWSHQPPRCIRISEKCQVCSPPTEPENGGYRCHPSPCPSLTQKTVIEYFCDEGYALKG
DYKFLTCQNGEWDGPMQISCRLTQDKEPSSPLGIPALSIVASTASSVALILLLVVLFVLV
QPKLKSFHHNRPIRREQGVSGQSSSIMVEGVQVALPSYEEAVYGSGGPGDDSAPPETRVP
IVLSEGLPQGASGGQSASRARLSRDLDFCLPSTSSLTSFSSRRHAETVLDHQAPCSSSSS
SSSWAREHPGGACAGPLPLRRDSGSSDQHSVLSITSTDDFSDDIPLLKEA
Download sequence
Identical sequences G3NYI2
69293.ENSGACP00000010402 ENSGACP00000010402 ENSGACP00000010402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]