SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010501 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010501
Domain Number 1 Region: 401-623
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 5.63e-78
Family Fibrinogen C-terminal domain-like 0.00000165
Further Details:      
 
Domain Number 2 Region: 227-318
Classification Level Classification E-value
Superfamily Fibronectin type III 1.9e-18
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 3 Region: 139-228
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000157
Family Fibronectin type III 0.00084
Further Details:      
 
Domain Number 4 Region: 323-402
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000257
Family Fibronectin type III 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000010501
Domain Number - Region: 42-78
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0154
Family Growth factor receptor domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010501   Gene: ENSGACG00000007921   Transcript: ENSGACT00000010523
Sequence length 626
Comment pep:known_by_projection group:BROADS1:groupXX:9266834:9271375:-1 gene:ENSGACG00000007921 transcript:ENSGACT00000010523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHKISLLPGGCNGGCESEISALKGRLARLEREMSSLKDKCPCSANCPNDCGGNGECENG
KCICQQGFTGLDCSKCDKRHVSISERNVTFNNISYFVLSYFECNLYCTISETTKGKVKVT
VETVTLQRRSKIHKATAITGPEPATEMVFSNVTESSITVAWSKPKTAFTSFRVMFTNIMT
GESRFVTVESQLSYVVLSKLSAGSSYIISITTTKGRAQSDALTSLITTVPAPPTHLQVIN
VTDTRAVLQWTPSLGKVDRFILSYETSKIPNVTVTVMLSGNSVEHQLRGLQRGTLYTVKI
LSQKDSLQSMAISTTFTTANVVKASEVGARSAVIAWRTSTVVYYSYRLTYQVAGEETKEV
ILDQSTTEYKLTGLLPTSRYIVLVQGERDGQYTSVVTTEFITGKLRFPFPTECSQELLNG
ALQSGEVDIYPHGKAGQAVRVYCDMDTDGGGWTVFQRRMNGKTDFYKTWNEYSAGFGNLS
EDFWLGNELLHNLTSVGPVSLRVDMLSGNDTAYAHYANFSVDSAERHYTLAVSGYTGTAG
DSMRYHNGRPFSAKDKDPDPLGINCARAYMGGWWYKNCYKANLNGLYGSNSDNQGVVWID
WRGKDSSVPFAEMKFRPSRFSPATHG
Download sequence
Identical sequences G3NYT0
ENSGACP00000010501 ENSGACP00000010501 69293.ENSGACP00000010501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]