SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010927 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010927
Domain Number 1 Region: 344-373,462-573
Classification Level Classification E-value
Superfamily TIMP-like 0.0000000000345
Family Netrin-like domain (NTR/C345C module) 0.065
Further Details:      
 
Domain Number 2 Region: 255-313
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000144
Family Laminin-type module 0.032
Further Details:      
 
Domain Number 3 Region: 374-413
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000103
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 4 Region: 80-163
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000035
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010927   Gene: ENSGACG00000008270   Transcript: ENSGACT00000010950
Sequence length 575
Comment pep:known_by_projection group:BROADS1:groupV:10257364:10276787:1 gene:ENSGACG00000008270 transcript:ENSGACT00000010950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLLVCAVSSHGPANPFAGQQTPVDPCYDDAGAARRCIPDFINAAFGKEMAVSSACGRPPS
RSCSVVERGDDRPSVRTCQICDATDPRRAHPASYLTDHNSAHNLTCWQSENLNSSPHNVT
LTLSLGKKFEITYVSLQFCSPRPESLAIHKSMDYGKTWVPYQFYSSQCRRMYNRPNRAAI
TKQNEQEALCTDGHTDPYPLSGGLIAFSTLDGRPSSKDFDNSPVLQDWVTVTDIRVVFMP
TYFYAVGDFQVGGRCKCNGHGARCLKDKEGKLVCDCKHNTEGPECDRCKPFHYDRPWQRA
NAREANECLPCNCNLHARRCRFNMELYKLSGRKSGGVCMNCRHNTAGRHCHYCKEGFYRD
LARPISHRRACKACDCHPVGAAGKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPVAP
CIKIPVVNPTAVVSSTEEPADCESYCKPVKGNLKINMKKIRQKGFAVQVNVLNMEPSGPP
KFQESGVRVQEPRRPLKRGDNRPVGPRRPCLQISQIQMDKRSCDGGSDAGAPSPGAEPFG
LLPDKTSLVIQWRDFWPRPLRKFQRKEKKGEVQQG
Download sequence
Identical sequences G3P004
69293.ENSGACP00000010927 ENSGACP00000010927 ENSGACP00000010927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]